| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human SMAD1 is produced by our E, coli expression system and the target gene encoding Met1-Ser465 is expressed with a GST tag at the N-terminus |
| Molecular Weight: |
69 kD, 78 |
| UniProt number: |
Q15797 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 8, 0 , 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
SMAD1 (N-GST), SMAD Family Member 1 |
| Short name: |
SMAD1 (N-GST), Recombinant SMAD Family Member 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
SMAD family member 1 (N-GST), sapiens SMAD family Member 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BSP-1 and BSP1 and JV4-1 and JV41 and MADH1 and MADR1, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006954 and inflammatory response and biological process this GO :0007165 and signal transduction and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007183 and SMAD protein complex assembly and biological process this GO :0007276 and gamete generation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009880 and embryonic pattern specification and biological process this GO :0010243 and response to organonitrogen compound and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010656 and negative regulation of muscle cell apoptotic process and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0019901 and protein kinase binding and molecular function this GO :0030509 and BMP signaling pathway and biological process this GO :0030618 and transforming growth factor beta receptor, SMAD1 and IDBG-39936 and ENSG00000170365 and 4086, SMAD1 and IDBG-629431 and ENSBTAG00000002835 and 540488, Smad1 and IDBG-170516 and ENSMUSG00000031681 and 17125, nuclei, pathway-specific cytoplasmic mediator activity, pathway-specific cytoplasmic mediator activity and also this GO :0042802 : identical protein binding and also this GO :0046872 : metal ion binding and also this GO :0070410 : co-SMAD binding and also this GO :0070411 : I-SMAD binding, pathway-specific cytoplasmic mediator activity and molecular function this GO :0030901 and midbrain development and biological process this GO :0030902 and hindbrain development and biological process this GO :0031053 and primary miRNA processing and biological process this GO :0042060 and wound healing and biological process this GO :0042493 and response to drug and biological process this GO :0042592 and homeostatic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043234 and protein complex and cellular component this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0045669 and positive regulation of osteoblast differentiation and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046872 and metal ion binding and molecular function this GO :0050775 and positive regulation of dendrite morphogenesis and biological process this GO :0051216 and cartilage development and biological process this GO :0060038 and cardiac muscle cell proliferation and biological process this GO :0060348 and bone development and biological process this GO :0061036 and positive regulation of cartilage development and biological process this GO :0070410 and co-SMAD binding and molecular function this GO :0070411 and I-SMAD binding and molecular function this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071773 and cellular response to BMP stimulus and biological process this GO :1901522 and positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus and biological process, this GO :0000165 and MAPK cascade and biological process this GO :0000979 and RNA polymerase II core promoter sequence-specific DNA binding and molecular function this GO :0001657 and ureteric bud development and biological process this GO :0001710 and mesodermal cell fate commitment and biological process this GO :0001822 and kidney development and biological process this GO :0002051 and osteoblast fate commitment and biological process this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005057 and receptor signaling protein activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005637 and nuclear inner membrane and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005667 and transcription factor complex and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005057 : receptor signaling protein activity and also this GO :0005515 : protein binding and also this GO :0019901 : protein kinase binding and also this GO :0030618 : transforming growth factor beta receptor, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005057 : receptor signaling protein activity, this GO :0005515 : protein binding, this GO :0019901 : protein kinase binding, this GO :0030618 : transforming growth factor beta receptor, this GO :0042802 : identical protein binding, this GO :0046872 : metal ion binding, this GO :0070410 : co-SMAD binding, this GO :0070411 : I-SMAD binding, transforming growth factor beta receptor, SMAD family member 1 |
| Identity: |
6767 |
| Gene: |
SMAD1 |
More about : SMAD1 |
| Long gene name: |
SMAD family member 1 |
| Synonyms gene: |
MADH1 |
| Synonyms gene name: |
MAD, mothers against DPP homolog 1 (Drosophila) , mothers against decapentaplegic homolog 1 (Drosophila) SMAD |
| Synonyms: |
MADR1 JV4-1 |
| Locus: |
4q31, 21 |
| Discovery year: |
1996-11-15 |
| GenBank acession: |
U59423 |
| Entrez gene record: |
4086 |
| Pubmed identfication: |
8653785 8673135 |
| RefSeq identity: |
NM_005900 |
| Classification: |
SMAD family |
| Havana BLAST/BLAT: |
OTTHUMG00000161592 |