Recombinant Human SMAD Family Member 1, SMAD1 (N-GST)

Contact us
Catalog number: CE81
Price: 985 €
Supplier: adi
Product name: Recombinant Human SMAD Family Member 1, SMAD1 (N-GST)
Quantity: 100 μg
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human SMAD1 is produced by our E, coli expression system and the target gene encoding Met1-Ser465 is expressed with a GST tag at the N-terminus
Molecular Weight: 69 kD, 78
UniProt number: Q15797
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 8, 0 , 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SMAD1 (N-GST), SMAD Family Member 1
Short name: SMAD1 (N-GST), Recombinant SMAD Family Member 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SMAD family member 1 (N-GST), sapiens SMAD family Member 1, recombinant H
Alternative technique: rec
Alternative to gene target: BSP-1 and BSP1 and JV4-1 and JV41 and MADH1 and MADR1, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006954 and inflammatory response and biological process this GO :0007165 and signal transduction and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007183 and SMAD protein complex assembly and biological process this GO :0007276 and gamete generation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009880 and embryonic pattern specification and biological process this GO :0010243 and response to organonitrogen compound and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010656 and negative regulation of muscle cell apoptotic process and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0019901 and protein kinase binding and molecular function this GO :0030509 and BMP signaling pathway and biological process this GO :0030618 and transforming growth factor beta receptor, SMAD1 and IDBG-39936 and ENSG00000170365 and 4086, SMAD1 and IDBG-629431 and ENSBTAG00000002835 and 540488, Smad1 and IDBG-170516 and ENSMUSG00000031681 and 17125, nuclei, pathway-specific cytoplasmic mediator activity, pathway-specific cytoplasmic mediator activity and also this GO :0042802 : identical protein binding and also this GO :0046872 : metal ion binding and also this GO :0070410 : co-SMAD binding and also this GO :0070411 : I-SMAD binding, pathway-specific cytoplasmic mediator activity and molecular function this GO :0030901 and midbrain development and biological process this GO :0030902 and hindbrain development and biological process this GO :0031053 and primary miRNA processing and biological process this GO :0042060 and wound healing and biological process this GO :0042493 and response to drug and biological process this GO :0042592 and homeostatic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043234 and protein complex and cellular component this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0045669 and positive regulation of osteoblast differentiation and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046872 and metal ion binding and molecular function this GO :0050775 and positive regulation of dendrite morphogenesis and biological process this GO :0051216 and cartilage development and biological process this GO :0060038 and cardiac muscle cell proliferation and biological process this GO :0060348 and bone development and biological process this GO :0061036 and positive regulation of cartilage development and biological process this GO :0070410 and co-SMAD binding and molecular function this GO :0070411 and I-SMAD binding and molecular function this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071773 and cellular response to BMP stimulus and biological process this GO :1901522 and positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus and biological process, this GO :0000165 and MAPK cascade and biological process this GO :0000979 and RNA polymerase II core promoter sequence-specific DNA binding and molecular function this GO :0001657 and ureteric bud development and biological process this GO :0001710 and mesodermal cell fate commitment and biological process this GO :0001822 and kidney development and biological process this GO :0002051 and osteoblast fate commitment and biological process this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005057 and receptor signaling protein activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005637 and nuclear inner membrane and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005667 and transcription factor complex and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005057 : receptor signaling protein activity and also this GO :0005515 : protein binding and also this GO :0019901 : protein kinase binding and also this GO :0030618 : transforming growth factor beta receptor, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005057 : receptor signaling protein activity, this GO :0005515 : protein binding, this GO :0019901 : protein kinase binding, this GO :0030618 : transforming growth factor beta receptor, this GO :0042802 : identical protein binding, this GO :0046872 : metal ion binding, this GO :0070410 : co-SMAD binding, this GO :0070411 : I-SMAD binding, transforming growth factor beta receptor, SMAD family member 1
Identity: 6767
Gene: SMAD1 | More about : SMAD1
Long gene name: SMAD family member 1
Synonyms gene: MADH1
Synonyms gene name: MAD, mothers against DPP homolog 1 (Drosophila) , mothers against decapentaplegic homolog 1 (Drosophila) SMAD
Synonyms: MADR1 JV4-1
Locus: 4q31, 21
Discovery year: 1996-11-15
GenBank acession: U59423
Entrez gene record: 4086
Pubmed identfication: 8653785 8673135
RefSeq identity: NM_005900
Classification: SMAD family
Havana BLAST/BLAT: OTTHUMG00000161592

Related Products :

MBS619767 Smad1, Smad5, Smad8, Smad9 (SMAD-1, SMAD-5, SMAD-8, SMAD8A, SMAD8B, SMAD-9, BSP1, BSP-1, CMT2D, DPC4, GARS, HMN5, hSMAD1, hSMAD4, JV41, JV51, MAD Homolog 5, Mad-related Protein 1, MADR1, Madh6, Mothers Against Decapentaplegic Homolog 1, Mothers Against DP Antibody 100ug 569 € MBS Polyclonals_1 human
MBS623200 Smad2 (SMAD Family Member 2, SMAD 2, SMAD-2, hMAD-2, hSMAD2, JV18-1, JV18, MAD-related Protein 2, MADR2, MGC22139, MGC34440, Mothers Against Decapentaplegic Homolog 2, Mothers Against DPP Homolog 2, MAD Homolog 2, MADH2) Antibody 100ug 873 € MBS Polyclonals_1 human
CE81 Recombinant Human SMAD Family Member 1, SMAD1 (N-GST) 10 µg 202 € novo human
MBS621815 SNIP1 (Smad Nuclear Interacting Protein 1 (Smad Nuclear Interacting), Smad Nuclear-interacting Protein, dJ423B22.2, FLJ12553, RP3-423B22.3, Splicing Factor Arginine/serine Rich 4 (Pre mRNA Splicing Factor SRP75)) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS619552 SMAD3 (Mothers Against Decapentaplegic Homolog 3, Mothers Against DPP Homolog 3, MAD Homolog 3, Mad3, SMAD Family Member 3, SMAD 3, Smad3, JV15-2, MADH3) 50ug 928 € MBS Polyclonals_1 human
MBS621967 SMAD3 (Mothers Against Decapentaplegic Homolog 3, Mothers Against DPP Homolog 3, MAD Homolog 3, Mad3, SMAD Family Member 3, SMAD 3, Smad3, JV15-2, MADH3) 50ug 630 € MBS Polyclonals_1 human
MBS624142 SMAD3, phosphorylated (Ser208) (Mothers Against Decapentaplegic Homolog 3, SMAD 3, Mothers Against DPP Homolog 3, MAD Homolog 3, Mad3, hMAD-3, SMAD Family Member 3, JV15-2, hSMAD3, MADH3) Antibody 200ul 603 € MBS Polyclonals_1 human
GWB-F1FB7D Recombinant Human SMAD Family Member 2 bulk Ask price € genways bulk human
CF52 Recombinant Human SMAD Family Member 4, SMAD4, DPC4 (C-6His) 500 µg 1613 € novo human
abx262859 Anti-SMAD Family Member 2 Protein (Recombinant) 2 µg 238 € abbex human
R32238 SMAD Antibody (SMAD1-5) 0.1mg 406 € NJS poly human
MBS621828 Smad3, phosphorylated (Ser423/425) (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, hMAD-3, hSMAD3, HSPC193, HsT17436, JV15-2, Mad3, MADH3, MGC60396, Mothers Against Decapentaplegic Homolog 3, Mothers Against DPP Homolog 3) Antibody 100ul 625 € MBS Polyclonals_1 human
MBS620240 ABCA4 (ATP Binding Cassette Sub-family A Member 4, ATP-binding Cassette Sub-family A (ABC1) Member 4, ABCA 4, ABCR, ARMD 2, ARMD2, ATP Binding Cassette 10, ABC10, ATP-binding Transporter Retina Specific, CORD3, FFM, Photoreceptor Rim Protein, Retina-speci 100ug 509 € MBS Polyclonals_1 human
MBS619325 ABCB10 (ABCB10 ATP Binding Cassette, Sub-family B (MDR/TAP) Member 10, ATP-binding Cassette Sub-family B Member 10 Mitochondrial, ABCB 10, ATP-binding Cassette Transporter 10, ABC Transporter 10 Protein, EST20237, Mitochondrial ATP Binding Cassette 2, M A Antibody 100ug 707 € MBS Polyclonals_1 human
MBS620422 ABCB10 (ABCB10 ATP Binding Cassette, Sub-family B (MDR/TAP) Member 10, ATP-binding Cassette Sub-family B Member 10 Mitochondrial, ATP-binding Cassette Transporter 10, ABC Transporter 10 Protein, EST20237, Mitochondrial ATP Binding Cassette 2, M ABC2, M-AB 100ug 509 € MBS Polyclonals_1 human
MBS619748 Aldehyde Dehydrogenase Family 3, Member A2 (Aldh3A2, Aldehyde dehydrogenase, microsomal, Aldehyde dehydrogenase 10, Aldehyde dehydrogenase family 3 member A2, ALDH10, DKFZp686E23276, FALDH, Fatty aldehyde dehydrogenase, FLJ20851, SLS) Antibody 100ug 536 € MBS Polyclonals_1 human
MBS619554 aldo keto reductase family 1, member C2 (AKR1C2, 3-alpha-HSD3, AKR1C-pseudo, Aldo-keto reductase family 1 member C2, BABP, Chlordecone reductase homolog HAKRD, DD, DD/BABP, DD2, DDH2, Dihydrodiol dehydrogenase/bile acid-binding protein, Dihydrodiol dehydr Antibody 0.04 mg 370 € MBS Polyclonals_1 human
MBS624084 CFTR/MRP, (ATP-Binding Cassette, sub-family C, Member 13, PRED6, ABCC13 ATP-binding cassette, sub-family C (CFTR/MRP), member 13, pseudogene) Antibody 100ug 509 € MBS Polyclonals_1 human
MBS623700 CKIP-1, NT (Pleckstrin Homology Domain-containing Family O Member 1, PH Domain-containing Family O Member 1, Casein Kinase 2-interacting Protein 1, CK2-interacting Protein 1, CKIP-1, C-Jun-binding Protein, JBP, Osteoclast Maturation-associated Gene 120 Pr Antibody 200ul 603 € MBS Polyclonals_1 human
MBS613943 MRP4 (Multidrug Resistance-associated Protein 4, ATP-binding Cassette Sub-family C (CFTR/MRP) Member 4, ATP Binding Cassette Sub-family C Member 4, ABCC4, bA464I2.1, Canalicular Multispecific Organic Anion Transporter ABC Superfamily, Canalicular Multispe 100ug 735 € MBS Polyclonals_1 human
MBS619621 MRP5 (Multidrug Resistance-associated Protein 5, ABC33, ATP-binding Cassette Sub-family C (CFTR/MRP) Member 5, ATP Binding Cassette Sub-family C Member 5, ABCC5, Canalicular Multispecific Organic Anion Transporter C, DKFZp686C1782, EST277145, Multispecifi 100ug 735 € MBS Polyclonals_1 human
MBS621617 Solute Carrier Family 12a3 (Slc12a3, Sodium/chloride transporters, member 3, Na-Cl symporter, NCC, Solute carrier family 12 member 3, Thiazide- sensitive sodium-chloride cotransporter, Tsc, TSC) 100ul 641 € MBS Polyclonals_1 human
MBS621227 Urea Transporter A1 (Slc14a2. Solute carrier family 14 (urea transporter), member 2, Slc14a2T, Solute carrier family 14 member 2, Urea transporter, kidney, Urea transporter 2, UrT1-C, UrT1-D, Ut2) Antibody 100ul 641 € MBS Polyclonals_1 human
MBS611694 VGAT (solute carrier family 32 (GABA vesicular transporter) member 1, GABA and glycine transporter, SLC32A 1, Solute carrier family 32 member 1, VGAT, VIAAT, Vesicular GABA Amino Acid Transporter, Vesicular GABA transporter, Vesicular inhibitory amino aci 50ug 685 € MBS Polyclonals_1 human
MBS624379 WASF3 (Wiskott-Aldrich Syndrome Protein Family Member 3, WASP Family Protein Member 3, Protein WAVE-3, Verprolin Homology Domain-containing Protein 3, KIAA0900, SCAR3, WAVE3) Antibody 100ug 658 € MBS Polyclonals_1 human
MBS623297 WIPF1 (WAS/WASL interacting protein family, Member 1, MGC111041, PRPL-2, PRPL-2 protein, WAS/WASL interacting protein family member 1, WASP-interacting protein, WASPIP, WIP, Wiskott-Aldrich syndrome protein interacting protein, Wiskott-Aldrich syndrome pr Antibody 100ug 591 € MBS Polyclonals_1 human
MBS623141 Zic1 (Zinc Finger Protein of the Cerebellum 1, Zic Family Member 1 (Odd-paired Drosophila Homolog), Zic Family Member 1, Zic 1, Zic-1, ZIC, Odd Paired Homolog Drosophila, Zinc Finger Protein ZIC 1, Zinc Finger Protein ZIC1, ZNF201) 100ul 630 € MBS Polyclonals_1 drosophila
GSTA35-R-100 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 100 μg 985 € adi human
GSTA35-R-25 Recombinant purified human GST-alpha 3 (GST A3-3) protein biologically active 25 μg 405 € adi human
GSTA15-R-100 Recombinant purified human GST-alpha (GST-A1) protein biologically active 100 μg 985 € adi human