| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SMAD (SMAD1-5) |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the SMAD antibody should be determined by the researcher |
| Intented use: |
This SMAD antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q15797 |
| Purity: |
Antigen affinity |
| Description: |
In response to signals by the TGF-beta superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus, It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals, R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, The SMADs, These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4, act as transcription factors that regulate the expression of certain genes, and SMAD8, often in complex with other SMADs/CoSMAD, SMADs are proteins that modulate the activity of transforming growth factor beta ligands |
| Immunogen: |
Amino acids QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH of human SMAD1-5 were used as the immunogen for the SMAD antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SMAD antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Nuclear and cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SMAD (SMAD1-5) |
| Short name: |
SMAD Antibody (SMAD1-5) |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
SMAD (Antibody to) (SMAD family member 1-5) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
BSP-1 and BSP1 and JV4-1 and JV41 and MADH1 and MADR1, DNA-templated and biological process this GO :0006355 and regulation of transcription, DNA-templated and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006468 and protein phosphorylation and biological process this GO :0006954 and inflammatory response and biological process this GO :0007165 and signal transduction and biological process this GO :0007179 and transforming growth factor beta receptor signaling pathway and biological process this GO :0007183 and SMAD protein complex assembly and biological process this GO :0007276 and gamete generation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009880 and embryonic pattern specification and biological process this GO :0010243 and response to organonitrogen compound and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010656 and negative regulation of muscle cell apoptotic process and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0019901 and protein kinase binding and molecular function this GO :0030509 and BMP signaling pathway and biological process this GO :0030618 and transforming growth factor beta receptor, SMAD1 and IDBG-39936 and ENSG00000170365 and 4086, SMAD1 and IDBG-629431 and ENSBTAG00000002835 and 540488, Smad1 and IDBG-170516 and ENSMUSG00000031681 and 17125, nuclei, pathway-specific cytoplasmic mediator activity, pathway-specific cytoplasmic mediator activity and also this GO :0042802 : identical protein binding and also this GO :0046872 : metal ion binding and also this GO :0070410 : co-SMAD binding and also this GO :0070411 : I-SMAD binding, pathway-specific cytoplasmic mediator activity and molecular function this GO :0030901 and midbrain development and biological process this GO :0030902 and hindbrain development and biological process this GO :0031053 and primary miRNA processing and biological process this GO :0042060 and wound healing and biological process this GO :0042493 and response to drug and biological process this GO :0042592 and homeostatic process and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043234 and protein complex and cellular component this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0045669 and positive regulation of osteoblast differentiation and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046872 and metal ion binding and molecular function this GO :0050775 and positive regulation of dendrite morphogenesis and biological process this GO :0051216 and cartilage development and biological process this GO :0060038 and cardiac muscle cell proliferation and biological process this GO :0060348 and bone development and biological process this GO :0061036 and positive regulation of cartilage development and biological process this GO :0070410 and co-SMAD binding and molecular function this GO :0070411 and I-SMAD binding and molecular function this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071773 and cellular response to BMP stimulus and biological process this GO :1901522 and positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus and biological process, this GO :0000165 and MAPK cascade and biological process this GO :0000979 and RNA polymerase II core promoter sequence-specific DNA binding and molecular function this GO :0001657 and ureteric bud development and biological process this GO :0001710 and mesodermal cell fate commitment and biological process this GO :0001822 and kidney development and biological process this GO :0002051 and osteoblast fate commitment and biological process this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005057 and receptor signaling protein activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005637 and nuclear inner membrane and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005667 and transcription factor complex and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0006351 and transcription, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding, this GO :0000979 : RNA polymerase II core promoter sequence-specific DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005057 : receptor signaling protein activity and also this GO :0005515 : protein binding and also this GO :0019901 : protein kinase binding and also this GO :0030618 : transforming growth factor beta receptor, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005057 : receptor signaling protein activity, this GO :0005515 : protein binding, this GO :0019901 : protein kinase binding, this GO :0030618 : transforming growth factor beta receptor, this GO :0042802 : identical protein binding, this GO :0046872 : metal ion binding, this GO :0070410 : co-SMAD binding, this GO :0070411 : I-SMAD binding, transforming growth factor beta receptor, SMAD family member 1 |