Recombinant Human Autophagy Related 3 Homolog, ATG3 (C-6His, N-T7 tag)

Contact us
Catalog number: CE30
Price: 1895 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Autophagy Related 3 Homolog, ATG3 (C-6His, N-T7 tag)
Quantity: 100ug
Other quantities: 1 mg 557€ 10 µg 80€ 500 µg 405€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human Autophagy protein 3 is produced by our E, coli expression system and the target gene encoding Met1-His287 is expressed with a T7 tag at the N-terminus
Molecular Weight: 35 kD
UniProt number: Q9NT62
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MASMTGGQQMGRGSMQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ATG3 (C-6His, N-T7 tag), Autophagy Related 3 Homolog
Short name: ATG3 (C-6His, N-T7 tag), Recombinant Autophagy 3 Homolog
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Label: tag
Species: Humans, Human
Alternative name: N-T7 detection labelled), autophagy related 3 (C-6His, sapiens Autophagy Related 3 Homolog, recombinant H
Alternative technique: rec
Alternative to gene target: ATG3 and IDBG-49891 and ENSG00000144848 and 64422, ATG3 and IDBG-632300 and ENSBTAG00000009084 and 508571, Atg3 and IDBG-162821 and ENSMUSG00000022663 and 67841, Cytoplasm, enzyme binding, this GO :0000045 and autophagic vacuole assembly and biological process this GO :0000153 and cytoplasmic ubiquitin ligase complex and cellular component this GO :0000422 and mitochondrion degradation and biological process this GO :0005515 and protein binding and molecular function this GO :0005829 and cytosol and cellular component this GO :0006464 and cellular protein modification process and biological process this GO :0006612 and protein targeting to membrane and biological process this GO :0006914 and autophagy and biological process this GO :0016567 and protein ubiquitination and biological process this GO :0019776 and Atg8 ligase activity and molecular function this GO :0019777 and Atg12 ligase activity and molecular function this GO :0019787 and small conjugating protein ligase activity and molecular function this GO :0019899 and enzyme binding and molecular function this GO :0043653 and mitochondrial fragmentation involved in apoptotic process and biological process this GO :0044804 and nucleophagy and biological process this GO :1902017 and regulation of cilium assembly and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0019776 : Atg8 ligase activity and also this GO :0019777 : Atg12 ligase activity and also this GO :0019787 : small conjugating protein ligase activity and also this GO :0019899 : enzyme binding, this GO :0019776 : Atg8 ligase activity, this GO :0019777 : Atg12 ligase activity, this GO :0019787 : small conjugating protein ligase activity, this GO :0019899 : enzyme binding, autophagy related 3
Identity: 20962
Gene: ATG3 | More about : ATG3
Long gene name: autophagy related 3
Synonyms gene: APG3L
Synonyms gene name: APG3 autophagy 3-like (S, cerevisiae) , cerevisiae) ATG3 autophagy related 3 homolog (S
Synonyms: PC3-96 FLJ22125 MGC15201 DKFZp564M1178
Locus: 3q13, 2
Discovery year: 2004-07-05
Entrez gene record: 64422
Pubmed identfication: 11825910
RefSeq identity: NM_022488
Classification: Autophagy related
Havana BLAST/BLAT: OTTHUMG00000159260

Related Products :

MBS618761 Atg3 (Autophagy-related Protein 3, APG3, ATG3 Autophagy Related 3 Homolog (S. cerevisiae), APG3-like, AUT1, Protein PC3-96) Antibody 100ul 652 € MBS Polyclonals_1 human
CE30 Recombinant Human Autophagy Related 3 Homolog, ATG3 (C-6His, N-T7 tag) 1 mg 557 € novo human
MBS612223 APG5 (APG5 Autophagy 5-like, APG5-like, APG5L, Apoptosis-specific Protein, ASP, ATG5 Autophagy-related 5 Homolog, Autophagy Protein 5, hAPG5, Homolog of S Cerevisiae Autophagy 5) Antibody 100ul 564 € MBS Polyclonals_1 human
MBS616231 Atg16L1 (Autophagy-related Protein 16-1, ATG16 Autophagy Related 16-like 1, APG16-like 1, APG16 Autophagy 16-like 1) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS612220 Atg4B (Cysteine Protease ATG4B, Autophagy-related Protein 4 Homolog B, Autophagin-1, Autophagy-related Cysteine Endopeptidase 1, AUT-like 1 Cysteine Endopeptidase, APG4B, AUTL1, KIAA0943) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS612897 Atg4C (Apg4c, Autl3, Cysteine Protease ATG4C, Autophagy-related Protein 4 Homolog C, Autophagin-3, Autophagy-related Cysteine Endopeptidase 3, AUT-like 3 Cysteine Endopeptidase) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS619226 ATG4D (ATG4 Autophagy Related 4 Homolog D, PG4D, APG4-D, AUTL4, AUT-like 4 Cysteine Endopeptidase, Autophagin-4, Autophagy-related Cysteine Endopeptidase 4, Autophagy-related Protein 4 Homolog D, Cysteine Protease ATG4D) 100ug 509 € MBS Polyclonals_1 human
MBS619934 ATG7 (APG7-Like, APG7L, ATG7 Autophagy-related 7 Homolog (S. cerevisiae), Autophagy Related Protein 7, DKFZp434N0735, GSA7, hAGP7, Ubiquitin Activating Enzyme E1-like Protein) Antibody 50ug 928 € MBS Polyclonals_1 human
CE33 Recombinant Human Autophagy Related 10 Homolog, ATG10 (C-6His, N-T7 tag) 50 µg 496 € novo human
MBS612054 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ul 564 € MBS Polyclonals_1 human
MBS612797 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ul 652 € MBS Polyclonals_1 human
MBS616373 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS616735 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 500ug 652 € MBS Polyclonals_1 human
MBS617427 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 0.25 miligrams 641 € MBS Polyclonals_1 human
MBS618240 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ul 564 € MBS Polyclonals_1 human
MBS620931 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ug 564 € MBS Polyclonals_1 human
MBS622327 Apg12 (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ug 674 € MBS Polyclonals_1 human
MBS620694 Apg12, IN (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS622859 Apg12, NT (Autophagy-related 12, 4931423H11Rik, A330058M13Rik, Atg12, Apg12L, APG12-like, Atg12L, Autophagy-related protein 12) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS618594 Atg8 (apg8, Autophagy-related Protein 8, ATG8, Autophagy-related Ubiquitin-like Modifier Apg8, Cytoplasm to Vacuole Targeting Protein 5) Antibody 500ug 829 € MBS Polyclonals_1 human
MBS611747 MAP1LC3A, NT (Microtubule Associated Protein 1 Light Chain 3 alpha, MAP1 Light Chain 3A, APG8, Autophagy Related Protein LC3A, Autophagy Related Ubiquitin-like Modifier LC3A, LC3A, MAP1 Light Chain 3 Like Protein 1, Microtubule Associated Proteins 1A/1B L Antibody 100ul 652 € MBS Polyclonals_1 human
MBS613995 MAP1LC3B (LC3B, Autophagy Related Protein LC3B, Autophagy Related Ubiquitin-like Modifier LC3B, MAP1 Light Chain 3-like Protein 2, Microtubule Associated Proteins 1A/1B Light Chain 3B, MAP1A/1B Light Chain 3B, MAP1A/MAP1B LC3B, Microtubule Associated Prot Antibody 100ul 636 € MBS Polyclonals_1 human
MBS616757 MAP1LC3C (Microtubule Associated Proteins 1A/1B Light Chain 3C, Autophagy Related Protein LC3C, Autophagy Related Ubiquitin-like Modifier LC3C, LC3C, LC3-like Protein 2, MAP1 Light Chain 3-like Protein 2, MAP1 Light Chain 3-like Protein 3, MAP1A/MAP1BLC3C Antibody 100ul 652 € MBS Polyclonals_1 human
CF50 Recombinant Human Autophagy Related 4 Homolog A, ATG4A (N-6His) 50 µg 496 € novo human
CE84 Recombinant Human Autophagy Related 4 Homolog C, ATG4C (C-6His) 500 µg 1613 € novo human
GENTAUR-58bd694837c95 Arabidopsis thaliana Autophagy-related protein 3 (ATG3) 100ug 1901 € MBS Recombinant Proteins human
GENTAUR-58bd6948711fb Arabidopsis thaliana Autophagy-related protein 3 (ATG3) 1000ug 1901 € MBS Recombinant Proteins human
GENTAUR-58bd6948bf5f1 Arabidopsis thaliana Autophagy-related protein 3 (ATG3) 100ug 2415 € MBS Recombinant Proteins human
GENTAUR-58bd6949166e7 Arabidopsis thaliana Autophagy-related protein 3 (ATG3) 1000ug 2415 € MBS Recombinant Proteins human
GENTAUR-58bd91b50b1f7 Candida glabrata Autophagy-related protein 3 (ATG3) 100ug 1895 € MBS Recombinant Proteins human