| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Inducible T-cell costimulator is produced by our Mammalian expression system and the target gene encoding Glu21-Phe141 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
40, 8 kD |
| UniProt number: |
Q9Y6W8 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
ICOS |
More about : ICOS |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
AILIM, CD278 (C-Fc), CRP-1, ICOS |
| Short name: |
AILIM, CD278 (C-Fc), CRP-1, Recombinant ICOS |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
AILIM, C-reactive protein, CD278 (C-fragment c), pentraxin-related-1, sapiens inducible T-cell co-stimulator, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
C-reactive protein, CRP and IDBG-103911 and ENSG00000132693 and 1401, CRP and IDBG-630749 and ENSBTAG00000013907 and 527553, Crp and IDBG-205690 and ENSMUSG00000037942 and 12944, Extracellular, Extracellular, ICOS and IDBG-643378 and ENSBTAG00000021596 and 507026, ICOS and IDBG-79246 and ENSG00000163600 and 29851, Icos and IDBG-159737 and ENSMUSG00000026009 and 54167, PTX1, classical pathway and biological process this GO :0007568 and aging and biological process this GO :0008228 and opsonization and biological process this GO :0010288 and response to lead ion and biological process this GO :0010745 and negative regulation of macrophage derived foam cell differentiation and biological process this GO :0010888 and negative regulation of lipid storage and biological process this GO :0015485 and cholesterol binding and molecular function this GO :0030169 and low-density lipoprotein particle binding and molecular function this GO :0030175 and filopodium and cellular component this GO :0030426 and growth cone and cellular component this GO :0033265 and choline binding and molecular function this GO :0042060 and wound healing and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0051258 and protein polymerization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071277 and cellular response to calcium ion and biological process this GO :1900006 and positive regulation of dendrite development and biological process, pentraxin-related, protein binding, protein homodimerization activity, this GO :0001666 and response to hypoxia and biological process this GO :0001849 and complement component C1q binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006953 and acute-phase response and biological process this GO :0006954 and inflammatory response and biological process this GO :0006958 and complement activation, this GO :0001849 : complement component C1q binding, this GO :0001849 : complement component C1q binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0015485 : cholesterol binding and also this GO :0030169 : low-density lipoprotein particle binding and also this GO :0033265 : choline binding and also this GO :0042803 : protein homodimerization activity, this GO :0002517 and T cell tolerance induction and biological process this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0031295 and T cell costimulation and biological process, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0015485 : cholesterol binding, this GO :0030169 : low-density lipoprotein particle binding, this GO :0033265 : choline binding, this GO :0042803 : protein homodimerization activity, inducible T-cell co-stimulator |
| Identity: |
5351 |
| Long gene name: |
inducible T-cell costimulator |
| Synonyms: |
AILIM CD278 |
| Synonyms name: |
activation-inducible lymphocyte immunomediatory molecule |
| Locus: |
2q33, 2 |
| Discovery year: |
2000-02-29 |
| GenBank acession: |
AB023135 |
| Entrez gene record: |
29851 |
| Pubmed identfication: |
9930702 10617205 |
| RefSeq identity: |
NM_012092 |
| Classification: |
CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000132880 |
| Locus Specific Databases: |
ICOSbase: Mutation registry for ICOS deficiency LRG_65 |