Recombinant Human ICOS, CRP-1, AILIM, CD278 (C-Fc)

Contact us
Catalog number: CC38
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human ICOS, CRP-1, AILIM, CD278 (C-Fc)
Quantity: 0.1ml
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Inducible T-cell costimulator is produced by our Mammalian expression system and the target gene encoding Glu21-Phe141 is expressed with a Fc tag at the C-terminus
Molecular Weight: 40, 8 kD
UniProt number: Q9Y6W8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: ICOS | More about : ICOS
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: AILIM, CD278 (C-Fc), CRP-1, ICOS
Short name: AILIM, CD278 (C-Fc), CRP-1, Recombinant ICOS
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: AILIM, C-reactive protein, CD278 (C-fragment c), pentraxin-related-1, sapiens inducible T-cell co-stimulator, recombinant H
Alternative technique: rec
Alternative to gene target: C-reactive protein, CRP and IDBG-103911 and ENSG00000132693 and 1401, CRP and IDBG-630749 and ENSBTAG00000013907 and 527553, Crp and IDBG-205690 and ENSMUSG00000037942 and 12944, Extracellular, Extracellular, ICOS and IDBG-643378 and ENSBTAG00000021596 and 507026, ICOS and IDBG-79246 and ENSG00000163600 and 29851, Icos and IDBG-159737 and ENSMUSG00000026009 and 54167, PTX1, classical pathway and biological process this GO :0007568 and aging and biological process this GO :0008228 and opsonization and biological process this GO :0010288 and response to lead ion and biological process this GO :0010745 and negative regulation of macrophage derived foam cell differentiation and biological process this GO :0010888 and negative regulation of lipid storage and biological process this GO :0015485 and cholesterol binding and molecular function this GO :0030169 and low-density lipoprotein particle binding and molecular function this GO :0030175 and filopodium and cellular component this GO :0030426 and growth cone and cellular component this GO :0033265 and choline binding and molecular function this GO :0042060 and wound healing and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0051258 and protein polymerization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071277 and cellular response to calcium ion and biological process this GO :1900006 and positive regulation of dendrite development and biological process, pentraxin-related, protein binding, protein homodimerization activity, this GO :0001666 and response to hypoxia and biological process this GO :0001849 and complement component C1q binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006953 and acute-phase response and biological process this GO :0006954 and inflammatory response and biological process this GO :0006958 and complement activation, this GO :0001849 : complement component C1q binding, this GO :0001849 : complement component C1q binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0015485 : cholesterol binding and also this GO :0030169 : low-density lipoprotein particle binding and also this GO :0033265 : choline binding and also this GO :0042803 : protein homodimerization activity, this GO :0002517 and T cell tolerance induction and biological process this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016337 and single organismal cell-cell adhesion and biological process this GO :0031295 and T cell costimulation and biological process, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0015485 : cholesterol binding, this GO :0030169 : low-density lipoprotein particle binding, this GO :0033265 : choline binding, this GO :0042803 : protein homodimerization activity, inducible T-cell co-stimulator
Identity: 5351
Long gene name: inducible T-cell costimulator
Synonyms: AILIM CD278
Synonyms name: activation-inducible lymphocyte immunomediatory molecule
Locus: 2q33, 2
Discovery year: 2000-02-29
GenBank acession: AB023135
Entrez gene record: 29851
Pubmed identfication: 9930702 10617205
RefSeq identity: NM_012092
Classification: CD molecules
Havana BLAST/BLAT: OTTHUMG00000132880
Locus Specific Databases: ICOSbase: Mutation registry for ICOS deficiency LRG_65

Related Products :

CC38 Recombinant Human ICOS, CRP-1, AILIM, CD278 (C-Fc) 50 µg 303 € novo human
RP-0820H Recombinant Human ICOS / AILIM / CD278 Protein (His & Fc Tag) 50μg 624 € adv human
RP-1333M Recombinant Mouse ICOS / AILIM / CD278 Protein (Fc Tag) 100μg 659 € adv mouse
RP-2161R Recombinant Rat ICOS / AILIM / CD278 Protein (Fc Tag) 50μg 456 € adv rat
MBS301742 Anti-Human CD278/ICOS PAb 7 ml (RTU) 354 € MBS Polyclonals_1 human
MBS301743 Anti-Human CD278/ICOS PAb 100ul 232 € MBS Polyclonals_1 human
MBS301744 Anti-Human CD278/ICOS PAb 1 mililiter 542 € MBS Polyclonals_1 human
MBS302088 Anti-Human CD278/ICOS PAb 500ul 387 € MBS Polyclonals_1 human
AP07922PU-N anti-CD278 / ICOS (171-186) Antibody 50 Вµg 732 € acr human
AP23811PU-M anti-CD278 / ICOS Antibody 0,5 ml 572 € acr human
AP23811PU-N anti-CD278 / ICOS Antibody 1 ml 804 € acr human
AP23811PU-S anti-CD278 / ICOS Antibody 0,1 ml 326 € acr human
AM20270PU-M anti-CD278 / ICOS (C-term) Antibody 0,5 ml 790 € acr human
AM20270PU-N anti-CD278 / ICOS (C-term) Antibody 1 ml 1109 € acr human
AM20270PU-S anti-CD278 / ICOS (C-term) Antibody 0,1 ml 471 € acr human
AP13108PU-N anti-CD278 / ICOS (C-term) Antibody 0,4 ml 587 € acr human
GENTAUR-58be60ce68137 Anti-ICOS/CD278 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-2583R-A350 ICOS/CD278 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2583R-A488 ICOS/CD278 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2583R-A555 ICOS/CD278 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2583R-A594 ICOS/CD278 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2583R-A647 ICOS/CD278 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2583R-Biotin ICOS/CD278 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-2583R ICOS/CD278 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-2583R-Cy3 ICOS/CD278 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2583R-Cy5 ICOS/CD278 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2583R-Cy5.5 ICOS/CD278 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2583R-Cy7 ICOS/CD278 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2583R-FITC ICOS/CD278 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-2583R-HRP ICOS/CD278 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human