| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
(C-6His) is a &alpha, IL-5 R&alpha, - or alpha protein sometimes glycoprotein present in blood, The Recombinant Mouse Interleukin-5 Receptor Subunit Alpha |
| Molecular Weight: |
37, 6 kD |
| UniProt number: |
P21183 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
(C-6His), IL-5 R&alpha, Interleukin-5 Receptor Subunit Alpha |
| Short name: |
(C-6His), IL-5 R&alpha, Recombinant Mouse Interleukin-5 Receptor Subunit Alpha |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses |
| Alternative name: |
(C-6His), Interleukin-5 R&alpha, recombinant Mouse Interleukin-5 Receptor functionnal sequence a |
| Alternative technique: |
rec |
| Identity: |
6016 |
| Gene: |
IL5 |
More about : IL5 |
| Long gene name: |
interleukin 5 |
| Synonyms gene name: |
eosinophil) , interleukin 5 (colony-stimulating factor |
| Synonyms: |
IL-5 EDF TRF |
| Synonyms name: |
eosinophil , interleukin-5 T-cell replacing factor B cell differentiation factor I eosinophil differentiation factor colony-stimulating factor |
| Locus: |
5q31, 1 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
X04688 |
| Entrez gene record: |
3567 |
| Pubmed identfication: |
3498940 |
| RefSeq identity: |
NM_000879 |
| Classification: |
Interleukins |
| Havana BLAST/BLAT: |
OTTHUMG00000059496 |