| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
IL-4 R&alpha, (C-6His) is a &alpha, - or alpha protein sometimes glycoprotein present in blood, The Recombinant Interleukin-4 Receptor Subunit Alpha |
| Molecular Weight: |
24, 4 kD |
| UniProt number: |
P24394 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
IL-4 R&alpha, (C-6His), Interleukin-4 Receptor Subunit Alpha |
| Short name: |
IL-4 R&alpha, (C-6His), Recombinant Interleukin-4 Receptor Subunit Alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
Interleukin-4 R&alpha, sapiens Interleukin-4 Receptor functionnal sequence a, (C-6His), recombinant H |
| Alternative technique: |
rec |
| Identity: |
6014 |
| Gene: |
IL4 |
More about : IL4 |
| Long gene name: |
interleukin 4 |
| Synonyms: |
BSF1 IL-4 BCGF1 BCGF-1 MGC79402 |
| Synonyms name: |
B_cell stimulatory factor 1 lymphocyte stimulatory factor 1 B cell growth factor 1 |
| Locus: |
5q31, 1 |
| Discovery year: |
1988-08-10 |
| GenBank acession: |
M23442 |
| Entrez gene record: |
3565 |
| Pubmed identfication: |
3016727 |
| RefSeq identity: |
NM_000589 |
| Classification: |
Interleukins |
| Havana BLAST/BLAT: |
OTTHUMG00000059724 |