Recombinant Human IL-10 Receptor Subunit β, IL-10RB (C-6His)

Contact us
Catalog number: CC08
Price: 1877 €
Supplier: novo
Product name: Recombinant Human IL-10 Receptor Subunit β, IL-10RB (C-6His)
Quantity: 1 mg
Other quantities: 10 µg 100€ 50 µg 202€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human IL-10 Receptor beta is produced by our Mammalian expression system and the target gene encoding Met20-Ser220 is expressed with a 6His tag at the C-terminus
Molecular Weight: 24, 5 kD
UniProt number: Q08334
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IL-10RB (C-6His), IL-10 Receptor Subunit &beta
Short name: IL-10RB (C-6His), Recombinant IL-10 Receptor Subunit &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: Interleukin-10RB (C-6His), sapiens Interleukin-10 Receptor functionnal sequence &beta, recombinant H
Alternative technique: rec
Identity: 5962
Gene: IL10 | More about : IL10
Long gene name: interleukin 10
Synonyms: CSIF TGIF IL10A IL-10
Synonyms name: cytokine synthesis inhibitory factor T-cell growth inhibitory factor
Locus: 1q32, 1
Discovery year: 1991-10-31
GenBank acession: M57627
Entrez gene record: 3586
Pubmed identfication: 9162098
RefSeq identity: NM_000572
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000036386

Related Products :

CC08 Recombinant Human IL-10 Receptor Subunit β, IL-10RB (C-6His) 50 µg 202 € novo human
CC42 Recombinant Human IL-10 Receptor Subunit β, IL-10RB (C-Fc) 1 mg 912 € novo human
MBS617658 Nuclear Receptor LXR beta (NR1H2, Liver X Receptor beta, LX Receptor beta, LXRB, LXR-b, LXR beta, NER1, NERI, Nuclear Orphan Receptor LXR beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Oxysterols Receptor LXR beta, RIP15, Stero Antibody 100ug 735 € MBS Polyclonals_1 human
MBS619896 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX Receptor beta, LXRa, LXR-a, LXRalpha, LXRb, LXR-b, LXRbeta, NERI, NER-I, NR1H2, NR1H3, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 100ug 763 € MBS Polyclonals_1 human
MBS611189 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX receptor beta, LXRa, LXRalpha, LXRb, LXRbeta, NERI, NR1H2, NR1H3, Nuclear Orphan Receptor LXR alpha, Nuclear Orphan Receptor LXR beta, Nuclear Receptor Antibody 100ug 735 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
C380 Recombinant Human Platelet-Derived Growth Factor Receptor β, PDGFR-β (C-6His) 1 mg 1674 € novo human
MBS622393 Adrenergic Receptor, beta 2 (ADRB2, Adrenergic, Beta-2-, Receptor, Surface [Homo sapiens], HGNC:286, ADRB2R, ADRBR, B2AR, BAR, BETA2AR, beta-2 Adrenergic Receptor, beta-2 Adrenoceptor, Catecholamine Receptor) 100ug 707 € MBS Polyclonals_1 human
CJ81 Recombinant Human IL-2 Receptor Subunit β, IL-2RB, CD122 (C-6His) 50 µg 496 € novo human
CI32 Recombinant Human Neuronal Acetylcholine Receptor Subunit β-3, CHRNB3 (C-6His) 10 µg 156 € novo human
C496 Recombinant Human Oncostatin-M-Specific Receptor Subunit β, OSMRB, IL-31RB (C-6His) 10 µg 131 € novo human
MBS622505 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Ox-1-R, Ox1-R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) Antibody 100ug 652 € MBS Polyclonals_1 human
C632 Recombinant Human Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 1 mg 2283 € novo human
CF53 Recombinant Human Estrogen Receptor β, ERβ, NR3A2 (N-6His) 50 µg 369 € novo human
C358 Recombinant Human Interferon α, β Receptor 1, IFNAR1 (C-6His) 500 µg 1613 € novo human
C476 Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-6His) 50 µg 273 € novo human
CM42 Recombinant Mouse Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 10 µg 126 € novo mouse
C247 Recombinant Human cAMP-dependent Protein Kinase Inhibitor β, PKI-β (N-6His) 50 µg 496 € novo human
CH77 Recombinant Human Glia Maturation Factor β, GMF-β, GMFB (C-6His) 10 µg 100 € novo human
CM05 Recombinant Mouse Transforming Growth Factor-β Receptor Type II, TGFBR2 (C-6His) 50 µg 232 € novo human
MBS618092 P2X1 Receptor (ATP Receptor, H. sapiens mRNA for ATP Receptor, P2RX1 Protein, P2X Purinoceptor 1, P2X Receptor Subunit 1, Purinergic Receptor, Purinergic Receptor P2X Ligand-gated Ion Channel 1, Purinergic Receptor P2X1) Antibody 0.05 ml 630 € MBS Polyclonals_1 human
MBS611882 P2X3 Receptor (ATP Receptor, MGC129956, P2RX3, P2X Purinoceptor 3, P2X Receptor Subunit 3, Purinergic Receptor, Purinergic Receptor P2X Ligand-gated Ion Channel 3, Purinergic Receptor P2X3, Purinoceptor P2X3) 0.05 ml 630 € MBS Polyclonals_1 human
CJ77 Recombinant Human IL-2 Receptor Subunit α, IL-2RA, CD25 (C-6His) 1 mg 2283 € novo human
CB64 Recombinant Human IL-2 Receptor Subunit γ, IL-2RG, CD132 (C-Fc-6His) 50 µg 303 € novo human
C614 Recombinant Human IL-20 Receptor Subunit α, IL20RA (C-6His) 50 µg 273 € novo human
C952 Recombinant Human IL-22 Receptor Subunit α2, IL-22BP, IL-22RA2 (C-6His) 10 µg 156 € novo human
C691 Recombinant Human IL-6 Receptor Subunit α, IL-6RA, CD126 (C-6His) 10 µg 156 € novo human
CI03 Recombinant Human IL-7 Receptor Subunit α, IL-7RA, CD127 (C-Fc-6His) 500 µg 1613 € novo human
CS32 Recombinant Human Interleukin-13 Receptor Subunit Alpha-1, IL-13RA1(C-6His) 500 µg 659 € novo human
CS33 Recombinant Human Interleukin-4 Receptor Subunit Alpha, IL-4 Rα(C-6His) 1 mg 1877 € novo human