Recombinant Human Glia Maturation Factor β, GMF-β, GMFB (C-6His)

Contact us
Catalog number: CH77
Price: 509 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Glia Maturation Factor β, GMF-β, GMFB (C-6His)
Quantity: 100ug
Other quantities: 1 mg 1115€ 50 µg 156€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Glia maturation factor beta is produced by our E, coli expression system and the target gene encoding Met1-His142 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17, 7 kD
UniProt number: P60983
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM Tris, 200 mMsodium chloride, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFHLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: GMF-&beta, GMFB (C-6His), Glia Maturation Factor &beta
Short name: GMF-&beta, GMFB (C-6His), Recombinant Glia Maturation Factor &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: GMF-&beta, GMFB (C-6His), sapiens Glia Maturation Factor &beta, recombinant H
Alternative technique: rec
Identity: 4373
Gene: GMFB | More about : GMFB
Long gene name: glia maturation factor beta
Synonyms: GMF
Locus: 14q22, 2
Discovery year: 1992-10-15
GenBank acession: M86492
Entrez gene record: 2764
Pubmed identfication: 1712830
RefSeq identity: NM_004124
Havana BLAST/BLAT: OTTHUMG00000140307

Related Products :

CH77 Recombinant Human Glia Maturation Factor β, GMF-β, GMFB (C-6His) 10 µg 100 € novo human
AR09619PU-L anti-Glia maturation factor beta / GMFB (1-142, His-tag) Antibody 0,5 mg 1138 € acr human
AR09619PU-N anti-Glia maturation factor beta / GMFB (1-142, His-tag) Antibody 0,1 mg 485 € acr human
AR09484PU-N anti-Glia maturation factor beta / GMFB Antibody 10 Вµg 384 € acr human
AR09484PU-S anti-Glia maturation factor beta / GMFB Antibody 2 Вµg 253 € acr human
AE41847MO-48 ELISA test for Mouse Glia maturation factor beta (GMFB) 1x plate of 48 wells 373 € abebio mouse
AE41847MO Mouse Glia maturation factor beta (GMFB) ELISA Kit 48 wells plate 480 € ab-elisa elisas mouse
AE41847MO-96 Mouse Glia maturation factor beta (GMFB) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
GWB-5C3168 Recombinant Human Glia Maturation Factor Beta bulk Ask price € genways bulk human
abx260749 Anti-Glia Maturation Factor beta His Tag Protein (Recombinant) 1 mg 3559 € abbex human
abx166815 Anti-Glia Maturation Factor beta Protein (Recombinant) 100 μg 847 € abbex human
abx262215 Anti-Glia Maturation Factor beta Protein (Recombinant) 10 µg 340 € abbex human
abx262218 Anti-Glia Maturation Factor beta Protein (Recombinant) 2 µg 238 € abbex human
abx262262 Anti-Glia Maturation Factor beta Protein (Recombinant) 1 mg 6067 € abbex human
GWB-75591E Recombinant Human Glia Maturation Factor Gamma bulk Ask price € genways bulk human
abx167184 Anti-Glia Maturation Factor gamma Protein (Recombinant) 100 μg 891 € abbex human
abx260738 Anti-Glia Maturation Factor gamma Protein (Recombinant) 1 mg 3559 € abbex human
abx252553 Anti-Human Glia Maturation Factor, beta ELISA Kit inquire 50 € abbex human
abx128063 Anti-Glia Maturation Factor beta Antibody 100 μg 514 € abbex human
abx255674 Anti-Rat Glia Maturation Factor, beta ELISA Kit inquire 50 € abbex rat
E-EL-Ch0204 Chicken GMFβ (Glia Maturation Factor, Beta) ELISA Kit 96T 568 € elabsciences human
ZR-40-508 GMF beta Recombinant Protein 0.002 mg 256 € Zyagen human
GENTAUR-58b873f10e8c2 Human Glia maturation factor gamma (GMFG) 100ug 1475 € MBS Recombinant Proteins human
GENTAUR-58b873f14e620 Human Glia maturation factor gamma (GMFG) 1000ug 1475 € MBS Recombinant Proteins human
GENTAUR-58b873f1a23ef Human Glia maturation factor gamma (GMFG) 100ug 1978 € MBS Recombinant Proteins human
GENTAUR-58b873f21bdff Human Glia maturation factor gamma (GMFG) 1000ug 1978 € MBS Recombinant Proteins human
GWB-BIG09D Recombinant Human GMF-&beta; bulk Ask price € genways bulk human
AR09135PU-L anti-Glia maturation factor gamma / GMFG (1-142) Antibody 0,5 mg 1138 € acr human
AR09135PU-N anti-Glia maturation factor gamma / GMFG (1-142) Antibody 0,1 mg 485 € acr human
GENTAUR-58bdd6088b9bd Anti- Glia Maturation Factor Gamma (GMFg) Antibody 100ug 509 € MBS Polyclonals human