| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human IL-20 Receptor alpha is produced by our Mammalian expression system and the target gene encoding Val30-Lys250 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
26, 3 kD |
| UniProt number: |
Q9UHF4 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAKVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
IL20RA (C-6His), IL-20 Receptor Subunit &alpha |
| Short name: |
IL20RA (C-6His), Recombinant IL-20 Receptor Subunit &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
a (C-6His), interleukin 20 receptor, sapiens Interleukin-20 Receptor functionnal sequence &alpha, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
IL20RA and IDBG-633655 and ENSBTAG00000015638 and 509038, IL20RA and IDBG-96985 and ENSG00000016402 and 53832, Il20ra and IDBG-136067 and ENSMUSG00000020007 and 237313, Plasma membranes, alpha, interleukin-20 binding, this GO :0005515 and protein binding and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0042015 and interleukin-20 binding and molecular function this GO :0045124 and regulation of bone resorption and biological process this GO :2001244 and positive regulation of intrinsic apoptotic signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0042015 : interleukin-20 binding, this GO :0042015 : interleukin-20 binding, interleukin 20 receptor |
| Identity: |
6003 |
| Gene: |
IL20RA |
More about : IL20RA |
| Long gene name: |
interleukin 20 receptor subunit alpha |
| Synonyms gene name: |
alpha interleukin 20 receptor alpha subunit , interleukin 20 receptor |
| Synonyms: |
ZCYTOR7 IL-20R1 |
| Locus: |
6q23, 3 |
| Discovery year: |
2000-05-23 |
| GenBank acession: |
AF184971 |
| Entrez gene record: |
53832 |
| Pubmed identfication: |
10875937 11163236 |
| RefSeq identity: |
NM_014432 |
| Classification: |
Interleukin receptors |
| Havana BLAST/BLAT: |
OTTHUMG00000015654 |