| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
1 kD, 8 |
| UniProt number: |
P40224 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CXCL12, SDF-1 &alpha, C-X-C Motif Chemokine 12 |
| Short name: |
CXCL12, SDF-1 &alpha, Recombinant Mouse C-X-C Motif Chemokine 12 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses |
| Alternative name: |
SDF-1 &alpha, chemokine (C-X-C motif) ligand 12, recombinant Mouse C-X-C Motif Chemokine 12 |
| Alternative technique: |
rec |
| Alternative to gene target: |
CXCL12 and IDBG-632037 and ENSBTAG00000005077 and 613811, CXCL12 and IDBG-71595 and ENSG00000107562 and 6387, CXCR chemokine receptor binding, Cxcl12 and IDBG-180998 and ENSMUSG00000061353 and 20315, Extracellular, IRH and PBSF and SCYB12 and SDF1 and TLSF and TPAR1, this GO :0001569 and patterning of blood vessels and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001667 and ameboidal cell migration and biological process this GO :0001764 and neuron migration and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006955 and immune response and biological process this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007281 and germ cell development and biological process this GO :0007420 and brain development and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008015 and blood circulation and biological process this GO :0008045 and motor neuron axon guidance and biological process this GO :0008064 and regulation of actin polymerization or depolymerization and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008344 and adult locomotory behavior and biological process this GO :0008354 and germ cell migration and biological process this GO :0009314 and response to radiation and biological process this GO :0009408 and response to heat and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0022029 and telencephalon cell migration and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0031100 and organ regeneration and biological process this GO :0033603 and positive regulation of dopamine secretion and biological process this GO :0042098 and T cell proliferation and biological process this GO :0042379 and chemokine receptor binding and molecular function this GO :0043434 and response to peptide hormone and biological process this GO :0045087 and innate immune response and biological process this GO :0045236 and CXCR chemokine receptor binding and molecular function this GO :0045666 and positive regulation of neuron differentiation and biological process this GO :0045785 and positive regulation of cell adhesion and biological process this GO :0048842 and positive regulation of axon extension involved in axon guidance and biological process this GO :0050930 and induction of positive chemotaxis and biological process this GO :0051924 and regulation of calcium ion transport and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070098 and chemokine-mediated signaling pathway and biological process this GO :0090026 and positive regulation of monocyte chemotaxis and biological process this GO :0090280 and positive regulation of calcium ion import and biological process this GO :1902230 and negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :2000107 and negative regulation of leukocyte apoptotic process and biological process this GO :2000406 and positive regulation of T cell migration and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008009 : chemokine activity and also this GO :0008083 : growth factor activity and also this GO :0042379 : chemokine receptor binding and also this GO :0045236 : CXCR chemokine receptor binding, this GO :0008009 : chemokine activity, this GO :0008083 : growth factor activity, this GO :0042379 : chemokine receptor binding, this GO :0045236 : CXCR chemokine receptor binding, chemokine (C-X-C motif) ligand 12 |
| Identity: |
10672 |
| Gene: |
CXCL12 |
More about : CXCL12 |
| Long gene name: |
C-X-C motif chemokine ligand 12 |
| Synonyms gene: |
SDF1A SDF1B SDF1 |
| Synonyms gene name: |
stromal cell-derived factor 1 chemokine (C-X-C motif) ligand 12 |
| Synonyms: |
SCYB12 SDF-1a SDF-1b PBSF TLSF-a TLSF-b TPAR1 |
| Locus: |
10q11, 21 |
| Discovery year: |
1994-11-30 |
| GenBank acession: |
L36033 |
| Entrez gene record: |
6387 |
| Pubmed identfication: |
7490086 |
| RefSeq identity: |
NM_000609 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000018054 |