| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
79 kD, 8 |
| UniProt number: |
P48061 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CXCL12, SDF-1 (19-93), C-X-C Motif Chemokine 12 |
| Short name: |
CXCL12, SDF-1 (19-93), Recombinant C-X-C Motif Chemokine 12 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
SDF-1 (19-93), chemokine (C-X-C motif) ligand 12, sapiens C-X-C Motif Chemokine 12, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CXCL12 and IDBG-632037 and ENSBTAG00000005077 and 613811, CXCL12 and IDBG-71595 and ENSG00000107562 and 6387, CXCR chemokine receptor binding, Cxcl12 and IDBG-180998 and ENSMUSG00000061353 and 20315, Extracellular, IRH and PBSF and SCYB12 and SDF1 and TLSF and TPAR1, this GO :0001569 and patterning of blood vessels and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001667 and ameboidal cell migration and biological process this GO :0001764 and neuron migration and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006955 and immune response and biological process this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007281 and germ cell development and biological process this GO :0007420 and brain development and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008015 and blood circulation and biological process this GO :0008045 and motor neuron axon guidance and biological process this GO :0008064 and regulation of actin polymerization or depolymerization and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008344 and adult locomotory behavior and biological process this GO :0008354 and germ cell migration and biological process this GO :0009314 and response to radiation and biological process this GO :0009408 and response to heat and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0022029 and telencephalon cell migration and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0031100 and organ regeneration and biological process this GO :0033603 and positive regulation of dopamine secretion and biological process this GO :0042098 and T cell proliferation and biological process this GO :0042379 and chemokine receptor binding and molecular function this GO :0043434 and response to peptide hormone and biological process this GO :0045087 and innate immune response and biological process this GO :0045236 and CXCR chemokine receptor binding and molecular function this GO :0045666 and positive regulation of neuron differentiation and biological process this GO :0045785 and positive regulation of cell adhesion and biological process this GO :0048842 and positive regulation of axon extension involved in axon guidance and biological process this GO :0050930 and induction of positive chemotaxis and biological process this GO :0051924 and regulation of calcium ion transport and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070098 and chemokine-mediated signaling pathway and biological process this GO :0090026 and positive regulation of monocyte chemotaxis and biological process this GO :0090280 and positive regulation of calcium ion import and biological process this GO :1902230 and negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :2000107 and negative regulation of leukocyte apoptotic process and biological process this GO :2000406 and positive regulation of T cell migration and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008009 : chemokine activity and also this GO :0008083 : growth factor activity and also this GO :0042379 : chemokine receptor binding and also this GO :0045236 : CXCR chemokine receptor binding, this GO :0008009 : chemokine activity, this GO :0008083 : growth factor activity, this GO :0042379 : chemokine receptor binding, this GO :0045236 : CXCR chemokine receptor binding, chemokine (C-X-C motif) ligand 12 |
| Identity: |
10672 |
| Gene: |
CXCL12 |
More about : CXCL12 |
| Long gene name: |
C-X-C motif chemokine ligand 12 |
| Synonyms gene: |
SDF1A SDF1B SDF1 |
| Synonyms gene name: |
stromal cell-derived factor 1 chemokine (C-X-C motif) ligand 12 |
| Synonyms: |
SCYB12 SDF-1a SDF-1b PBSF TLSF-a TLSF-b TPAR1 |
| Locus: |
10q11, 21 |
| Discovery year: |
1994-11-30 |
| GenBank acession: |
L36033 |
| Entrez gene record: |
6387 |
| Pubmed identfication: |
7490086 |
| RefSeq identity: |
NM_000609 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000018054 |