Recombinant Human C-X-C Motif Chemokine 12, CXCL12, SDF-1 (19-93)

Contact us
Catalog number: C120
Price: 339 €
Supplier: novo
Product name: Recombinant Human C-X-C Motif Chemokine 12, CXCL12, SDF-1 (19-93)
Quantity: 50 µg
Other quantities: 1 mg 1836€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 79 kD, 8
UniProt number: P48061
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CXCL12, SDF-1 (19-93), C-X-C Motif Chemokine 12
Short name: CXCL12, SDF-1 (19-93), Recombinant C-X-C Motif Chemokine 12
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SDF-1 (19-93), chemokine (C-X-C motif) ligand 12, sapiens C-X-C Motif Chemokine 12, recombinant H
Alternative technique: rec
Alternative to gene target: CXCL12 and IDBG-632037 and ENSBTAG00000005077 and 613811, CXCL12 and IDBG-71595 and ENSG00000107562 and 6387, CXCR chemokine receptor binding, Cxcl12 and IDBG-180998 and ENSMUSG00000061353 and 20315, Extracellular, IRH and PBSF and SCYB12 and SDF1 and TLSF and TPAR1, this GO :0001569 and patterning of blood vessels and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001667 and ameboidal cell migration and biological process this GO :0001764 and neuron migration and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006955 and immune response and biological process this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007281 and germ cell development and biological process this GO :0007420 and brain development and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008015 and blood circulation and biological process this GO :0008045 and motor neuron axon guidance and biological process this GO :0008064 and regulation of actin polymerization or depolymerization and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008344 and adult locomotory behavior and biological process this GO :0008354 and germ cell migration and biological process this GO :0009314 and response to radiation and biological process this GO :0009408 and response to heat and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0022029 and telencephalon cell migration and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0031100 and organ regeneration and biological process this GO :0033603 and positive regulation of dopamine secretion and biological process this GO :0042098 and T cell proliferation and biological process this GO :0042379 and chemokine receptor binding and molecular function this GO :0043434 and response to peptide hormone and biological process this GO :0045087 and innate immune response and biological process this GO :0045236 and CXCR chemokine receptor binding and molecular function this GO :0045666 and positive regulation of neuron differentiation and biological process this GO :0045785 and positive regulation of cell adhesion and biological process this GO :0048842 and positive regulation of axon extension involved in axon guidance and biological process this GO :0050930 and induction of positive chemotaxis and biological process this GO :0051924 and regulation of calcium ion transport and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070098 and chemokine-mediated signaling pathway and biological process this GO :0090026 and positive regulation of monocyte chemotaxis and biological process this GO :0090280 and positive regulation of calcium ion import and biological process this GO :1902230 and negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :2000107 and negative regulation of leukocyte apoptotic process and biological process this GO :2000406 and positive regulation of T cell migration and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008009 : chemokine activity and also this GO :0008083 : growth factor activity and also this GO :0042379 : chemokine receptor binding and also this GO :0045236 : CXCR chemokine receptor binding, this GO :0008009 : chemokine activity, this GO :0008083 : growth factor activity, this GO :0042379 : chemokine receptor binding, this GO :0045236 : CXCR chemokine receptor binding, chemokine (C-X-C motif) ligand 12
Identity: 10672
Gene: CXCL12 | More about : CXCL12
Long gene name: C-X-C motif chemokine ligand 12
Synonyms gene: SDF1A SDF1B SDF1
Synonyms gene name: stromal cell-derived factor 1 chemokine (C-X-C motif) ligand 12
Synonyms: SCYB12 SDF-1a SDF-1b PBSF TLSF-a TLSF-b TPAR1
Locus: 10q11, 21
Discovery year: 1994-11-30
GenBank acession: L36033
Entrez gene record: 6387
Pubmed identfication: 7490086
RefSeq identity: NM_000609
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000018054

Related Products :

C120 Recombinant Human C-X-C Motif Chemokine 12, CXCL12, SDF-1 (19-93) 500 µg 1298 € novo human
C121 Recombinant Human C-X-C Motif Chemokine 12, CXCL12, SDF-1 (22-89) 1 mg 2283 € novo human
C122 Recombinant Human C-X-C Motif Chemokine 12, CXCL12, SDF-1 (22-93) 500 µg 1613 € novo human
C698 Recombinant Mouse C-X-C Motif Chemokine 12, CXCL12, SDF-1 α 1 mg 2283 € novo human
MBS612407 Stromal Cell Derived Factor 1alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (Biotin) Antibody 50ug 464 € MBS Polyclonals_1 human
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
GWB-BIG116 Recombinant Human SDF-1&alpha; (CXCL12) bulk Ask price € genways bulk human
GWB-BIG117 Recombinant Human SDF-1&beta; (CXCL12) bulk Ask price € genways bulk human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
GWB-BIG1A5 Recombinant Murine SDF-1&alpha; (CXCL12) bulk Ask price € genways bulk human
GWB-BIG1A6 Recombinant Murine SDF-1&beta; (CXCL12) bulk Ask price € genways bulk human
GWB-BIG1D2 Recombinant Rat SDF-1&alpha; (CXCL12) bulk Ask price € genways bulk rat
GWB-BIG1D3 Recombinant Rat SDF-1&beta; (CXCL12) bulk Ask price € genways bulk rat
GENTAUR-58be31bbb4dcf CCR8, loop2 (chemokine receptor 8, C-C chemokine receptor type 8, CC-CKR-8, C-C CKR-8, CCR-8, CDw198, Chemokine receptor-like 1, CKRL1) Antibody 100ul 707 € MBS mono human
MBS611205 LEC, NCC-4 (Liver-Expressed Chemokine, New Chemokine CC-4, Small Inducible Cytokine Subfamily A (Cys X Cys) member 16, SCYA16, IL-10-inducible Chemokine, Monotactin-1) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS619083 BCA-1 (B Cell Attracting Chemokine 1, BCA1, B Lymphocyte Chemoattractant, ANGIE, ANGIE2, BLC, BLR1 Ligand, BLR1L, Chemokine (C-X-C Motif) Ligand 13 (B-cell Chemoattractant), C-X-C Motif Chemokine 13, CXCL13, CXC Chemokine BLC, Small Inducible Cytokine B S Antibody 50ug 774 € MBS Polyclonals_1 human
MBS623554 CCR7 (C-C Chemokine Receptor Type 7, Chemokine (C-C Motif) Receptor 7, C-C CKR-7, CC-CKR-7, CCR-7, BLR2, CD197, CDw197, CMKBR7, Epstein-Barr Virus-induced G-protein Coupled Receptor 1, EBV Induced G Protein Coupled Receptor 1, EBI1, EVI1, MIP-3 beta Recep Antibody 100ug 619 € MBS Polyclonals_1 virus
MBS622999 TRIM3 (Tripartite Motif Containing 3, Tripartite Motif-containing 3, Tripartite Motif Protein TRIM3, Brain Expressed Ring Finger, Brain-expressed Ring Finger, BERP, HAC1, Ring Finger Protein 22, RNF22, Ring Finger Protein 97, RNF97) 100ug 785 € MBS Polyclonals_1 human
MBS621891 TRIM56 (Tripartite Motif Containing 56, Tripartite Motif-containing 56, Tripartite Motif Containing Protein 56, DKFZp667O116, A130009K11Rik, FLJ35608, Gm452, MGC37358, OTTMUSP00000027392, RING Finger Protein 109, RNF109) 100ul 785 € MBS Polyclonals_1 human
C094 Recombinant Human C-C Motif Chemokine 1, CCL1 500 µg 1613 € novo human
CF47 Recombinant Human C-C Motif Chemokine 11, CCL11, Eotaxin 50 µg 339 € novo human