Recombinant Mouse C-X-C Motif Chemokine 12, CXCL12, SDF-1 α

Contact us
Catalog number: C698
Price: 614 €
Supplier: genways
Product name: Recombinant Mouse C-X-C Motif Chemokine 12, CXCL12, SDF-1 α
Quantity: 1 x 1 vial
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 1 kD, 8
UniProt number: P40224
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CXCL12, SDF-1 &alpha, C-X-C Motif Chemokine 12
Short name: CXCL12, SDF-1 &alpha, Recombinant Mouse C-X-C Motif Chemokine 12
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses
Alternative name: SDF-1 &alpha, chemokine (C-X-C motif) ligand 12, recombinant Mouse C-X-C Motif Chemokine 12
Alternative technique: rec
Alternative to gene target: CXCL12 and IDBG-632037 and ENSBTAG00000005077 and 613811, CXCL12 and IDBG-71595 and ENSG00000107562 and 6387, CXCR chemokine receptor binding, Cxcl12 and IDBG-180998 and ENSMUSG00000061353 and 20315, Extracellular, IRH and PBSF and SCYB12 and SDF1 and TLSF and TPAR1, this GO :0001569 and patterning of blood vessels and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001667 and ameboidal cell migration and biological process this GO :0001764 and neuron migration and biological process this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006955 and immune response and biological process this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007281 and germ cell development and biological process this GO :0007420 and brain development and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008015 and blood circulation and biological process this GO :0008045 and motor neuron axon guidance and biological process this GO :0008064 and regulation of actin polymerization or depolymerization and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008344 and adult locomotory behavior and biological process this GO :0008354 and germ cell migration and biological process this GO :0009314 and response to radiation and biological process this GO :0009408 and response to heat and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009615 and response to virus and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0022029 and telencephalon cell migration and biological process this GO :0030334 and regulation of cell migration and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0031100 and organ regeneration and biological process this GO :0033603 and positive regulation of dopamine secretion and biological process this GO :0042098 and T cell proliferation and biological process this GO :0042379 and chemokine receptor binding and molecular function this GO :0043434 and response to peptide hormone and biological process this GO :0045087 and innate immune response and biological process this GO :0045236 and CXCR chemokine receptor binding and molecular function this GO :0045666 and positive regulation of neuron differentiation and biological process this GO :0045785 and positive regulation of cell adhesion and biological process this GO :0048842 and positive regulation of axon extension involved in axon guidance and biological process this GO :0050930 and induction of positive chemotaxis and biological process this GO :0051924 and regulation of calcium ion transport and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070098 and chemokine-mediated signaling pathway and biological process this GO :0090026 and positive regulation of monocyte chemotaxis and biological process this GO :0090280 and positive regulation of calcium ion import and biological process this GO :1902230 and negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :2000107 and negative regulation of leukocyte apoptotic process and biological process this GO :2000406 and positive regulation of T cell migration and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008009 : chemokine activity and also this GO :0008083 : growth factor activity and also this GO :0042379 : chemokine receptor binding and also this GO :0045236 : CXCR chemokine receptor binding, this GO :0008009 : chemokine activity, this GO :0008083 : growth factor activity, this GO :0042379 : chemokine receptor binding, this GO :0045236 : CXCR chemokine receptor binding, chemokine (C-X-C motif) ligand 12
Identity: 10672
Gene: CXCL12 | More about : CXCL12
Long gene name: C-X-C motif chemokine ligand 12
Synonyms gene: SDF1A SDF1B SDF1
Synonyms gene name: stromal cell-derived factor 1 chemokine (C-X-C motif) ligand 12
Synonyms: SCYB12 SDF-1a SDF-1b PBSF TLSF-a TLSF-b TPAR1
Locus: 10q11, 21
Discovery year: 1994-11-30
GenBank acession: L36033
Entrez gene record: 6387
Pubmed identfication: 7490086
RefSeq identity: NM_000609
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000018054

Related Products :

C698 Recombinant Mouse C-X-C Motif Chemokine 12, CXCL12, SDF-1 α 1 mg 2283 € novo human
C120 Recombinant Human C-X-C Motif Chemokine 12, CXCL12, SDF-1 (19-93) 500 µg 1298 € novo human
C121 Recombinant Human C-X-C Motif Chemokine 12, CXCL12, SDF-1 (22-89) 1 mg 2283 € novo human
C122 Recombinant Human C-X-C Motif Chemokine 12, CXCL12, SDF-1 (22-93) 500 µg 1613 € novo human
MBS612407 Stromal Cell Derived Factor 1alpha (SDF1 alpha, SDF1a, SDF-1a, Chemokine (C-X-C Motif) Ligand 12, CXCL12, hIRH, Pre-B cell Growth-stimulating Factor, PBSF, SCYB12, TLSF-a, TPAR1) (Biotin) Antibody 50ug 464 € MBS Polyclonals_1 human
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
GWB-BIG116 Recombinant Human SDF-1&alpha; (CXCL12) bulk Ask price € genways bulk human
GWB-BIG117 Recombinant Human SDF-1&beta; (CXCL12) bulk Ask price € genways bulk human
GWB-BIG1A5 Recombinant Murine SDF-1&alpha; (CXCL12) bulk Ask price € genways bulk human
GWB-BIG1A6 Recombinant Murine SDF-1&beta; (CXCL12) bulk Ask price € genways bulk human
GWB-BIG1D2 Recombinant Rat SDF-1&alpha; (CXCL12) bulk Ask price € genways bulk rat
GWB-BIG1D3 Recombinant Rat SDF-1&beta; (CXCL12) bulk Ask price € genways bulk rat
GENTAUR-58be31bbb4dcf CCR8, loop2 (chemokine receptor 8, C-C chemokine receptor type 8, CC-CKR-8, C-C CKR-8, CCR-8, CDw198, Chemokine receptor-like 1, CKRL1) Antibody 100ul 707 € MBS mono human
MBS611205 LEC, NCC-4 (Liver-Expressed Chemokine, New Chemokine CC-4, Small Inducible Cytokine Subfamily A (Cys X Cys) member 16, SCYA16, IL-10-inducible Chemokine, Monotactin-1) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS619083 BCA-1 (B Cell Attracting Chemokine 1, BCA1, B Lymphocyte Chemoattractant, ANGIE, ANGIE2, BLC, BLR1 Ligand, BLR1L, Chemokine (C-X-C Motif) Ligand 13 (B-cell Chemoattractant), C-X-C Motif Chemokine 13, CXCL13, CXC Chemokine BLC, Small Inducible Cytokine B S Antibody 50ug 774 € MBS Polyclonals_1 human
MBS623554 CCR7 (C-C Chemokine Receptor Type 7, Chemokine (C-C Motif) Receptor 7, C-C CKR-7, CC-CKR-7, CCR-7, BLR2, CD197, CDw197, CMKBR7, Epstein-Barr Virus-induced G-protein Coupled Receptor 1, EBV Induced G Protein Coupled Receptor 1, EBI1, EVI1, MIP-3 beta Recep Antibody 100ug 619 € MBS Polyclonals_1 virus
MBS622999 TRIM3 (Tripartite Motif Containing 3, Tripartite Motif-containing 3, Tripartite Motif Protein TRIM3, Brain Expressed Ring Finger, Brain-expressed Ring Finger, BERP, HAC1, Ring Finger Protein 22, RNF22, Ring Finger Protein 97, RNF97) 100ug 785 € MBS Polyclonals_1 human
MBS621891 TRIM56 (Tripartite Motif Containing 56, Tripartite Motif-containing 56, Tripartite Motif Containing Protein 56, DKFZp667O116, A130009K11Rik, FLJ35608, Gm452, MGC37358, OTTMUSP00000027392, RING Finger Protein 109, RNF109) 100ul 785 € MBS Polyclonals_1 human
C786 Recombinant Mouse C-X-C Motif Chemokine 1, CXCL1, GRO α (C-6His) 1 mg 2283 € novo human
GWB-560A58 recombinant MOUSE SDF-1 ALPHA 1 x 1 vial 614 € genways human