| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Interferon alpha-6 is produced by our Mammalian expression system and the target gene encoding Ser21-Glu189 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
1 kD, 21 |
| UniProt number: |
P05013 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKEVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
IFNA6 (C-6His), -6, Interferon &alpha |
| Short name: |
IFNA6 (C-6His), -6, Recombinant Interferon &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
alpha 6 (C-6His), interferon, sapiens Interferon &alpha, -6, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, IFN-alphaK, IFNA6 and IDBG-54082 and ENSG00000120235 and 3443, alpha 6, this GO :0002250 and adaptive immune response and biological process this GO :0002286 and T cell activation involved in immune response and biological process this GO :0002323 and natural killer cell activation involved in immune response and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005126 and cytokine receptor binding and molecular function this GO :0005132 and type I interferon receptor binding and molecular function this GO :0005575 and cellular component and cellular component this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006952 and defense response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007596 and blood coagulation and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030183 and B cell differentiation and biological process this GO :0033141 and positive regulation of peptidyl-serine phosphorylation of STAT protein and biological process this GO :0042100 and B cell proliferation and biological process this GO :0043330 and response to exogenous dsRNA and biological process this GO :0045087 and innate immune response and biological process this GO :0045343 and regulation of MHC class I biosynthetic process and biological process this GO :0051607 and defense response to virus and biological process this GO :0060337 and type I interferon signaling pathway and biological process this GO :0060338 and regulation of type I interferon-mediated signaling pathway and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005126 : cytokine receptor binding and also this GO :0005132 : type I interferon receptor binding, this GO :0005126 : cytokine receptor binding, this GO :0005132 : type I interferon receptor binding, type I interferon receptor binding, interferon |
| Identity: |
5427 |
| Gene: |
IFNA6 |
More about : IFNA6 |
| Long gene name: |
interferon alpha 6 |
| Synonyms gene name: |
alpha 6 , interferon |
| Synonyms: |
IFN-alphaK |
| Locus: |
9p21, 3 |
| Discovery year: |
1993-01-14 |
| Entrez gene record: |
3443 |
| Pubmed identfication: |
1385305 |
| RefSeq identity: |
NM_021002 |
| Classification: |
Interferons |
| Havana BLAST/BLAT: |
OTTHUMG00000019676 |