Recombinant Human Interferon α-6, IFNA6 (C-6His)

Contact us
Catalog number: C662
Price: 735 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Interferon α-6, IFNA6 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interferon alpha-6 is produced by our Mammalian expression system and the target gene encoding Ser21-Glu189 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 21
UniProt number: P05013
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKEVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IFNA6 (C-6His), -6, Interferon &alpha
Short name: IFNA6 (C-6His), -6, Recombinant Interferon &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: alpha 6 (C-6His), interferon, sapiens Interferon &alpha, -6, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, IFN-alphaK, IFNA6 and IDBG-54082 and ENSG00000120235 and 3443, alpha 6, this GO :0002250 and adaptive immune response and biological process this GO :0002286 and T cell activation involved in immune response and biological process this GO :0002323 and natural killer cell activation involved in immune response and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005126 and cytokine receptor binding and molecular function this GO :0005132 and type I interferon receptor binding and molecular function this GO :0005575 and cellular component and cellular component this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006952 and defense response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007596 and blood coagulation and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030183 and B cell differentiation and biological process this GO :0033141 and positive regulation of peptidyl-serine phosphorylation of STAT protein and biological process this GO :0042100 and B cell proliferation and biological process this GO :0043330 and response to exogenous dsRNA and biological process this GO :0045087 and innate immune response and biological process this GO :0045343 and regulation of MHC class I biosynthetic process and biological process this GO :0051607 and defense response to virus and biological process this GO :0060337 and type I interferon signaling pathway and biological process this GO :0060338 and regulation of type I interferon-mediated signaling pathway and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005126 : cytokine receptor binding and also this GO :0005132 : type I interferon receptor binding, this GO :0005126 : cytokine receptor binding, this GO :0005132 : type I interferon receptor binding, type I interferon receptor binding, interferon
Identity: 5427
Gene: IFNA6 | More about : IFNA6
Long gene name: interferon alpha 6
Synonyms gene name: alpha 6 , interferon
Synonyms: IFN-alphaK
Locus: 9p21, 3
Discovery year: 1993-01-14
Entrez gene record: 3443
Pubmed identfication: 1385305
RefSeq identity: NM_021002
Classification: Interferons
Havana BLAST/BLAT: OTTHUMG00000019676

Related Products :

C662 Recombinant Human Interferon α-6, IFNA6 (C-6His) 10 µg 202 € novo human
PBL11165-1 anti-IFNA6 / Interferon alpha-6 Antibody 1 x 10вЃµ U 529 € acr human
MBS610191 Fragilis (1 8U, Ifitm3, Interferon Induced Transmembrane Protein 3, Interferon inducible protein 1 8U, Interferon Inducible Protein 15, Interferon Inducible Protein Homolog) Antibody 100ug 558 € MBS Polyclonals_1 human
MBS612461 Interferon Stimulating Gene 15 (ISG15, 15kD Ubiquitin-like Modifier GIP2, G1P2, Interferon Induced 15kD Protein, IFI15, Interferon alpha Inducible Protein, Interferon Stimulated Protein 15kD, Ubiquitin Cross-reactive Protein, UCRP) Antibody 500ug 829 € MBS Polyclonals_1 human
LV186351 IFNA6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
LV186352 IFNA6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV186353 IFNA6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV186354 IFNA6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV186356 IFNA6 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 517 € ABM lentivectors human
LV186355 IFNA6 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 517 € ABM lentivectors human
abx216269 Anti-IFNA6 Antibody inquire 50 € abbex human
abx920229 Anti-IFNA6 siRNA 30 nmol 717 € abbex human
GWB-34545E IFNA6 Over-expression Lysate reagent 1 x 1 vial 463 € genways human
CC75 Recombinant Human Interferon α-1, 13 (C-6His) 500 µg 1755 € novo human
CC24 Recombinant Human Interferon α-4, IFNA4 (C-6His) 500 µg 1613 € novo human
C358 Recombinant Human Interferon α, β Receptor 1, IFNAR1 (C-6His) 500 µg 1613 € novo human
C476 Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-6His) 50 µg 273 € novo human
MBS614704 Interferon alpha-Inducible Protein 27 (IFI27, 2310061N23Rik, FAM14D, Interferon alpha-Induced 11.5kD Protein, ISG12, ISG12(a) Protein, P27) Antibody 100ug 785 € MBS Polyclonals_1 human
CI70 Recombinant Human Interferon γ Receptor 1, IFNGR1 (C-6His) 500 µg 709 € novo human
CS36 Recombinant Human Interferon Lambda-2, IL-28A(C-6His) 50 µg 369 € novo human
CC87 Recombinant Human Interferon ω-1, IFNW1 (C-6His) 500 µg 1613 € novo human
CF18 Recombinant Human Interferon Regulatory Factor 5, IRF5 (C-6His) 10 µg 202 € novo human
CM41 Recombinant Mouse Interferon γ, IFN-γ (C-6His) 50 µg 202 € novo human
CK42 Recombinant Mouse Interferon γ Receptor 1, IFN-γ R1, CD119 (C-6His) 1 mg 1674 € novo human
CM46 Recombinant Mouse Interferon ζ, IFN-ζ, Limitin (C-6His) 10 µg 202 € novo human
MBS616766 CXCL11 (Chemokine (C-X-C Motif) Ligand 11, b R1, H174, Interferon-inducible T Cell Alpha Chemoattractant, I-TAC, Interferon gamma Inducible Protein 9, IP-9, MGC102770, Small Inducible Cytokine B11, SCYB11, SCYB9B) Antibody 50ug 625 € MBS Polyclonals_1 human
C682 Recombinant Human α-N-Acetylneuraminide α-2,8-Sialyltransferase, ST8SIA1 (C-6His) 500 µg 1613 € novo human
C275 Recombinant Human α-Soluble NSF Attachment Protein, SNAP-α, NAPA (N-6His) 50 µg 496 € novo human
MBS619394 Spectrin, alpha (Spectrin alpha Chain, Spectrin alpha Chain Brain, Spectrin Non-erythroid alpha Chain, Alpha Fodrin, Alpha II Spectrin, FLJ44613, Fodrin alpha Chain, Non-erythrocytic Spectrin alpha, Spectrin alpha Non-erythrocytic 1, SPTAN1, SPTA2) Antibody 100ul 785 € MBS Polyclonals_1 human
MBS620094 T-Complex Protein 1 alpha (T Complex Protein 1 alpha Subunit, T Complex Protein 1 Subunit alpha, TCP1 alpha, TCP1-alpha, TCP-1 alpha, CCT 1, CCT1, CCT alpha, CCTa, D6S230E, T Complex 1, T-complex 1, T Complex Locus TCP1, T-complex Locus TCP-1, T Complex P 100ug 735 € MBS Polyclonals_1 human