Recombinant Human C-C motif chemokine 17, CCL17 (C-6His)

Contact us
Catalog number: C599
Price: 1613 €
Supplier: novo
Product name: Recombinant Human C-C motif chemokine 17, CCL17 (C-6His)
Quantity: 500 µg
Other quantities: 1 mg 1318€ 10 µg 126€ 50 µg 278€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human C-C motif chemokine 17 is produced by our Mammalian expression system and the target gene encoding Ala24­, Ser94 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 9
UniProt number: Q92583
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CCL17 (C-6His), C-C motif chemokine 17
Short name: CCL17 (C-6His), Recombinant C-C motif chemokine 17
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: chemokine (C-C motif) ligand 17 (C-6His), sapiens C-C motif chemokine 17, recombinant H
Alternative technique: rec
Alternative to gene target: A-152E5, CCL17 and IDBG-33236 and ENSG00000102970 and 6361, CCL17 and IDBG-632473 and ENSBTAG00000001191 and 100140488, CCR4 chemokine receptor binding, Ccl17 and IDBG-182659 and ENSMUSG00000031780 and 20295, Extracellular, this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008009 and chemokine activity and molecular function this GO :0031729 and CCR4 chemokine receptor binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008009 : chemokine activity and also this GO :0031729 : CCR4 chemokine receptor binding, this GO :0008009 : chemokine activity, this GO :0031729 : CCR4 chemokine receptor binding, 3 and ABCD-2 and SCYA17 and TARC, chemokine (C-C motif) ligand 17
Identity: 10615
Gene: CCL17 | More about : CCL17
Long gene name: C-C motif chemokine ligand 17
Synonyms gene: SCYA17
Synonyms gene name: member 17 chemokine (C-C motif) ligand 17 , small inducible cytokine subfamily A (Cys-Cys)
Synonyms: TARC ABCD-2
Locus: 16q21
Discovery year: 1996-10-26
GenBank acession: D43767
Entrez gene record: 6361
Pubmed identfication: 8702936 9070951
RefSeq identity: NM_002987
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000133468

Related Products :

C599 Recombinant Human C-C motif chemokine 17, CCL17 (C-6His) 10 µg 126 € novo human
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
AE51764CA Cat C-C motif chemokine 17 (CCL17) ELISA Kit 96 wells plate 810 € ab-elisa elisas cat
AE51764CA-96 Cat C-C motif chemokine 17 (CCL17) ELISA Kit 1x plate of 96 wells 671 € abebio cat
AE51764CA-48 ELISA test for Cat C-C motif chemokine 17 (CCL17) 1x plate of 48 wells 402 € abebio cat
GENTAUR-58bda76c1f6bc Macaca mulatta C-C motif chemokine 17 (CCL17) 100ug 1293 € MBS Recombinant Proteins human
GENTAUR-58bda76c8f089 Macaca mulatta C-C motif chemokine 17 (CCL17) 1000ug 1293 € MBS Recombinant Proteins human
GENTAUR-58bda76ce9d2b Macaca mulatta C-C motif chemokine 17 (CCL17) 100ug 1796 € MBS Recombinant Proteins human
GENTAUR-58bda76d68ab6 Macaca mulatta C-C motif chemokine 17 (CCL17) 1000ug 1796 € MBS Recombinant Proteins human
GWB-9D84CB Recombinant Human Thymus and Activation Regulated Chemokine (CCL17) bulk Ask price € genways bulk human
GWB-2C34BF Recombinant Human Thymus and Activation Regulated Chemokine (CCL17) His Tag bulk Ask price € genways bulk human
C439 Recombinant Human C-C Motif Chemokine 14, CCL14, HCC-3 (C-6His) 10 µg 156 € novo human
CF38 Recombinant Human C-C Motif Chemokine 18, CCL18, PARC (N-6His) 10 µg 202 € novo human
CC43 Recombinant Human C-C Motif Chemokine 24, CCL24, Eotaxin-2, MPIF-2 (C-6His) 1 mg 2283 € novo human
C515 Recombinant Human C-C Motif Chemokine 3-Like 1, CCL3L1 (C-6His) 10 µg 202 € novo human
C569 Recombinant Human C-C Motif Chemokine 4, CCL4 (C-6His) 500 µg 1613 € novo human
CJ28 Recombinant Human C-C Motif Chemokine 5, CCL5, RANTES (C-Fc-6His) 1 mg 2486 € novo human
CC95 Recombinant Human C-C Motif Chemokine 8, CCL8, MCP-2 (C-6His) 1 mg 2283 € novo human
C597 Recombinant Human C-X-C Motif Chemokine 1, CXCL1 (C-6His) 1 mg 1836 € novo human
CD32 Recombinant Human C-X-C Motif Chemokine 10, CXCL10 (C-Fc-6His) 500 µg 1613 € novo human