Recombinant Human Preadipocyte Factor-1, Protein δ Homolog 1, Pref-1, DLK-1 (C-6His)

Contact us
Catalog number: C463
Price: 303 €
Supplier: novo
Product name: Recombinant Human Preadipocyte Factor-1, Protein δ Homolog 1, Pref-1, DLK-1 (C-6His)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human DLK-1 is produced by our Mammalian expression system and the target gene encoding Ala24-Pro297 is expressed with a 6His tag at the C-terminus
Molecular Weight: 15 kD, 30
UniProt number: P80370
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: DLK-1 (C-6His), Homolog 1, Pref-1, Protein &delta, Preadipocyte Factor-1
Short name: DLK-1 (C-6His), Homolog 1, Pref-1, Protein &delta, Recombinant Preadipocyte Factor-1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: DLK-1 (C-6His), Homolog 1, Pref-1, Protein &delta, sapiens Preadipocyte Factor-1, recombinant H
Alternative technique: rec

Related Products :

C463 Recombinant Human Preadipocyte Factor-1, Protein δ Homolog 1, Pref-1, DLK-1 (C-6His) 1 mg 2283 € novo human
102-PA137 Anti-Human DLK-1/Pref-1 200ug 271 € Reliatech antibodies human
PREF11-P Human Preadipocyte factor-1 (Pref-1) control/blocking peptide # 1 100 μg 188 € adi human
PREF11-A Rabbit Anti-Human Preadipocyte factor-1 (Pref-1) IgG # 1, aff pure 100 μg 565 € adi human
PREF12-P Mouse Preadipocyte factor-1 (Pref-1) control/blocking peptide # 2 100 μg 188 € adi mouse
PREF12-A Rabbit Anti-Mouse Preadipocyte factor-1 (Pref-1) IgG # 2, aff pure 100 μg 565 € adi mouse
MBS613217 Preadipocyte Factor 1 (Pref1, Fetal Antigen 1, FA1, Delta Drosophila homolog-like 1, DLK1, Zona Glomerulosa-specific Factor, ZOG) 50ug 492 € MBS Polyclonals_1 drosophila
MBS611654 Preadipocyte Factor 1 (Pref1, Fetal Antigen 1, FA1, Delta Drosophila homolog-like 1, DLK1, Zona Glomerulosa-specific Factor, ZOG) Antibody 50ug 492 € MBS Polyclonals_1 drosophila
F41292-0.08ML DLK Antibody 0.08 ml 199 € NJS poly human
F41292-0.4ML DLK Antibody 0.4 ml 406 € NJS poly human
101-M607 Anti-Human Pref-1 100ug 336 € Reliatech antibodies human
MBS623808 DGKD, CT (Diacylglycerol Kinase delta, Diglyceride Kinase delta, DGK-delta, DAG Kinase delta, 130kD Diacylglycerol Kinase, KIAA0145) Antibody 200ul 603 € MBS Polyclonals_1 human
CF68 Recombinant Human DNA Polymerase δ Subunit 2, POLD2 (C-6His) 500 µg 1755 € novo human
C239 Recombinant Human Neurocalcin-δ, NCALD (N-6His) 500 µg 1613 € novo human
MBS624586 DNA Polymerase delta Interacting Protein p38, ID (Polymerase delta-interacting Protein 2, 38kD DNA Polymerase delta Interaction Protein, p38, HSPC017, POLD4, PDIP38, POLDIP2) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS618369 Protein Phosphatase 1D Magnesium-dependent, delta (PPM1D, PP2C delta, PP2C-delta, PP2CD, EC 3.1.3.16, p53-induced Protein Phosphatase 1, Protein Phosphatase 2C delta Isoform, Protein Phosphatase 2C Isoform delta, Protein Phosphatase Magnesium-dependent 1 100ul 785 € MBS Polyclonals_1 human
MBS621620 DNA polymerase delta interaction protein, p46 (POLDIP3, SKAR, polymerase (DNA-directed), delta interacting protein 3, 46kD DNA polymerase delta interaction protein, KIAA1649, p46, PDIP46, Polymerase delta-interacting protein 3) Antibody 100ul 614 € MBS Polyclonals_1 human
CS63 Recombinant Cynomolgus CD3d , CD3 delta Protein (C-6His) 1 mg 2283 € novo human
MBS613987 RAE1 (RAE1 (RNA Export 1 S. pombe) Homolog, RAE1 Homolog, Rae1 Protein Homolog, RAE1 RNA Export 1 Homolog, RNA Export 1, RNA Export 1 Homolog, dJ481F12.3, dJ800J21.1, FLJ30608, Homolog of yeast Rae1 mRNA-associated Protein of 41kD, MGC117333, MGC126076, M 100ug 735 € MBS Polyclonals_1 human
MBS624086 Opioid Receptor, delta (OPRD1, Opioid Receptor delta, Delta-type Opioid Receptor, DOR-1, OPRD) 5 ml 558 € MBS Polyclonals_1 human
MBS623686 Opioid Receptor, delta (OPRD1, Opioid Receptor delta, Delta-type Opioid Receptor, DOR-1, OPRD) Antibody 0.05 ml 790 € MBS Polyclonals_1 human
C479 Recombinant Human Coagulation Factor III, Tissue Factor, CD142 (C-6His) 1 mg 2283 € novo human
C424 Recombinant Human Anterior Gradient Protein 2 Homolog, AG-2, HPC8, AGR2 (C-6His) 10 µg 156 € novo human
C553 Recombinant Human Anterior Gradient Protein 3 Homolog, AG-3, BCMP11, AGR3 (C-6His) 50 µg 369 € novo human
C650 Recombinant Human Vitelline Membrane Outer Layer Protein 1 Homolog, VMO1 (C-6His) 50 µg 369 € novo human
CE33 Recombinant Human Autophagy Related 10 Homolog, ATG10 (C-6His, N-T7 tag) 50 µg 496 € novo human
CE30 Recombinant Human Autophagy Related 3 Homolog, ATG3 (C-6His, N-T7 tag) 1 mg 557 € novo human
CF50 Recombinant Human Autophagy Related 4 Homolog A, ATG4A (N-6His) 50 µg 496 € novo human
CE84 Recombinant Human Autophagy Related 4 Homolog C, ATG4C (C-6His) 500 µg 1613 € novo human
CS41 Recombinant Human B7 Homolog 6, B7-H6, NCR3LG1(C-6His) 50 µg 303 € novo human