Recombinant Human Adipocyte Adhesion Molecule, ASAM, CLMP, ACAM (C-6His)

Contact us
Catalog number: C427
Price: 600 €
Supplier: ABM lentivectors
Product name: Recombinant Human Adipocyte Adhesion Molecule, ASAM, CLMP, ACAM (C-6His)
Quantity: 1.0 µg DNA
Other quantities: 10 µg 131€ 50 µg 273€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are 
Molecular Weight: 25, 38 kD
UniProt number: Q9H6B4
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ACAM (C-6His), ASAM, CLMP, Adipocyte Adhesion Molecule
Short name: ACAM (C-6His), ASAM, CLMP, Recombinant Adipocyte Adhesion Molecule
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ACAM (C-6His), ASAM, CLMP, sapiens Adipocyte Adhesion Molecule, recombinant H
Alternative technique: rec
Identity: 24039
Gene: CLMP | More about : CLMP
Long gene name: CXADR like membrane protein
Synonyms: ASAM FLJ22415 ACAM
Synonyms name: adipocyte-specific adhesion molecule coxsackie- and adenovirus receptor-like membrane protein adipocyte adhesion molecule
Locus: 11q24, 1
Discovery year: 2011-01-27
GenBank acession: BC009371
Entrez gene record: 79827
Pubmed identfication: 12851705 14573622
RefSeq identity: NM_024769
Classification: I-set domain containing Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000166031

Related Products :

C427 Recombinant Human Adipocyte Adhesion Molecule, ASAM, CLMP, ACAM (C-6His) 50 µg 273 € novo human
AR51463PU-N anti-ACAM / ASAM (19-235, His-tag) Antibody 0,5 mg 1109 € acr human
AR51463PU-S anti-ACAM / ASAM (19-235, His-tag) Antibody 0,1 mg 485 € acr human
AP50265PU-N anti-ACAM / ASAM (Center) Antibody 0,4 ml 587 € acr human
RP-0095H Recombinant Human ASAM / CLMP Protein (His Tag) 50μg 624 € adv human
RP-1033M Recombinant Mouse ASAM / CLMP Protein (His Tag) 50μg 624 € adv mouse
RP-2009R Recombinant Rat ASAM / CLMP Protein (His Tag) 50μg 624 € adv rat
MBS624553 FABP4, phosphorylated (Tyr20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS619883 SH3 and PX domain-containing protein 2B (SH3PXD2B, Factor for adipocyte differentiation 49, SH3 and PX domains 2B, Factor for adipocyte differentiation 49, Fad49, KIAA1295) Antibody 100ug 663 € MBS Polyclonals_1 human
C435 Recombinant Human Cell Adhesion Molecule 3, CADM3, IGSF4B, SynCAM3 (C-6His) 500 µg 1613 € novo human
C341 Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-6His) 50 µg 263 € novo human
C522 Recombinant Human Hepatocyte Cell Adhesion Molecule, HepaCAM (C-6His) 10 µg 202 € novo human
C322 Recombinant Human Intercellular Adhesion Molecule 1, ICAM-1, CD54 (C-6His) 500 µg 1613 € novo human
C306 Recombinant Human Intercellular Adhesion Molecule 2, ICAM-2, CD102 (C-6His) 1 mg 2283 € novo human
C468 Recombinant Human Junctional Adhesion Molecule A, JAM-A, CD321 (C-6His) 50 µg 369 € novo human
C359 Recombinant Human Junctional Adhesion Molecule B, JAM-B, CD322 (C-6His) 50 µg 263 € novo human
CP45 Recombinant Human Neural Cell Adhesion Molecule 1, NCAM-1, CD56 (C-6His) 1 mg 2283 € novo human
CS74 Recombinant Human Platelet Endothelial Cell Adhesion Molecule, PECAM-1, CD31 (C-6His) 50 µg 202 € novo human
RP-837 Recombinant (E.Coli, His-tag) Human Intercellular Adhesion Molecule-1 10 μg 333 € adi human
RP-840 Recombinant (E.Coli, His-tag) Human Vascular cell adhesion molecule 1 10 μg 333 € adi human
CD29 Recombinant Human Endothelial Cell Adhesion Molecule, ESAM (C-Fc) 10 µg 146 € novo human
RP-0660H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein 50μg 624 € adv human
RP-0659H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein (Fc Tag) 50μg 624 € adv human
RP-0658H Recombinant Human ESAM / Endothelial Cell Adhesion Molecule Protein (His Tag) 50μg 624 € adv human
CD35 Recombinant Human Intercellular Adhesion Molecule 1, ICAM-1, CD54 (C-Fc) 1 mg 2283 € novo human
CC52 Recombinant Human Junctional Adhesion Molecule B, JAM-B, CD322 (C-Fc) 500 µg 1613 € novo human
CC04 Recombinant Human Neuronal Cell Adhesion Molecule, NRCAM (C-Fc) 50 µg 303 € novo human
abx151097 Anti-Human CLMP ELISA Kit inquire 50 € abbex human
abx571864 Anti-Human CLMP ELISA Kit inquire 50 € abbex human
LV796329 CLMP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human