| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
present in lysates used as reference for ELISA quantification of these molecules and their subunits, Whole adhesion and interacting molecules are |
| Molecular Weight: |
3 kD, 50 |
| UniProt number: |
P57087 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD322 (C-Fc), JAM-B, Junctional Adhesion Molecule B |
| Short name: |
CD322 (C-Fc), JAM-B, Recombinant Junctional Adhesion Molecule B |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD322 (C-fragment c), JAM-B, sapiens Junctional Adhesion Molecule B, recombinant H |
| Alternative technique: |
rec |
| Identity: |
14686 |
| Gene: |
JAM2 |
More about : JAM2 |
| Long gene name: |
junctional adhesion molecule 2 |
| Synonyms gene: |
C21orf43 |
| Synonyms: |
VE-JAM JAM-B JAMB CD322 |
| Locus: |
21q21, 3 |
| Discovery year: |
2001-04-25 |
| GenBank acession: |
AF255910 |
| Entrez gene record: |
58494 |
| Pubmed identfication: |
10779521 10945976 |
| Classification: |
I-set domain containing CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000078441 |