Recombinant Human N-Acetylglucosamine-6-Sulfatase, GNS (C-6His)

Catalog number:	C354 Buy Now
Price:	558 €
Supplier:	MBS Polyclonals
Product name:	Recombinant Human N-Acetylglucosamine-6-Sulfatase, GNS (C-6His)
Quantity:	0.2 mg
Other quantities:	1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:	human gns sapiens chis alternative valleu

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human N-Acetylglucosamine-6-Sulfatase is produced by our Mammalian expression system and the target gene encoding Val37-Leu552 is expressed with a 6His tag at the C-terminus
Molecular Weight:	35 kD, 59
UniProt number:	P15586
State of the product:	Liquid
Shipping conditions:	Dry Ice/ice packs
Formulation:	150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0
Storage recommendations:	-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution:	Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	VFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLLVDHHHHHH
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	GNS (C-6His), N-Acetylglucosamine-6-Sulfatase
Short name:	GNS (C-6His), Recombinant N-Acetylglucosamine-6-Sulfatase
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	GNS (C-6His), sapiens N-Acetylglucosamine-6-Sulfatase, recombinant H
Alternative technique:	rec
Identity:	4422
Gene:	GNS | More about : GNS
Long gene name:	glucosamine (N-acetyl)-6-sulfatase
Synonyms name:	Sanfilippo disease IIID N-acetylglucosamine-6-sulfatase
Locus:	12q14, 3
Discovery year:	1988-06-09
Entrez gene record:	2799
Classification:	Sulfatases
Havana BLAST/BLAT:	OTTHUMG00000168819

• #human
• #gns
• #sapiens
• #chis
• #alternative
• #valleu