Recombinant Human Sulfatase Modifying Factor 1, SUMF1 (C-6His)

Contact us
Catalog number: C501
Price: 333 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Human Sulfatase Modifying Factor 1, SUMF1 (C-6His)
Quantity: 0.1ml
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human SUMF1 is produced by our Mammalian expression system and the target gene encoding Ser34-Asp374 is expressed with a 6His tag at the C-terminus
Molecular Weight: 27 kD, 38
UniProt number: Q8NBK3
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 150 mM sodium chloride, 2 mM CaCl2, pH 7, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMDVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SUMF1 (C-6His), Sulfatase Modifying Factor 1
Short name: SUMF1 (C-6His), Recombinant Sulfatase Modifying Factor 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SUMF1 (C-6His), sapiens Sulfatase Modifying Factor 1, recombinant H
Alternative technique: rec
Identity: 20376
Gene: SUMF1 | More about : SUMF1
Long gene name: sulfatase modifying factor 1
Synonyms: FGE UNQ3037
Locus: 3p26, 1
Discovery year: 2004-04-30
GenBank acession: BC017005
Entrez gene record: 285362
Pubmed identfication: 12757705 12757706
RefSeq identity: NM_182760
Havana BLAST/BLAT: OTTHUMG00000090269

Related Products :

C501 Recombinant Human Sulfatase Modifying Factor 1, SUMF1 (C-6His) 500 µg 1613 € novo human
DL-SUMF1-Hu Human Sulfatase Modifying Factor 1 SUMF1 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bdcf4ac4426 Anti- Sulfatase Modifying Factor 1 (SUMF1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcf4b0bb16 Anti- Sulfatase Modifying Factor 1 (SUMF1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd18b6093f Anti- Sulfatase Modifying Factor 1 (SUMF1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bddcec0aa1d Anti- Sulfatase Modifying Factor 1 (SUMF1) Antibody 100ug 564 € MBS Polyclonals human
EKU07495 Sulfatase Modifying Factor 1 (SUMF1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
MBS621742 Bcl 2 Modifying Factor (Bcl2 Modifying Factor, Bcl-2 Modifying Factor, BMF, FLJ00065) Antibody 50ug 928 € MBS Polyclonals_1 human
MBS622973 RAMP1 (Receptor Activity Modifying Protein1, Receptor Activity Modifying Protein 1 [Precursor], Receptor (G Protein-coupled) Activity Modifying Protein 1, Calcitonin Receptor-like Receptor Activity Modifying Protein 1, CRLR Activity Modifying Protein 1) Antibody 100ug 591 € MBS Polyclonals_1 human
abx262933 Anti-Sulfatase Modifying Factor 1 Protein (Recombinant) 1 mg 6662 € abbex human
C354 Recombinant Human N-Acetylglucosamine-6-Sulfatase, GNS (C-6His) 10 µg 202 € novo human
GWB-P0737I SUMF1, 91-374aa, Recombinant Protein bulk Ask price € genways bulk human
abx153191 Anti-Human SUMF1 ELISA Kit inquire 50 € abbex human
abx570850 Anti-Human SUMF1 ELISA Kit inquire 50 € abbex human
abx145717 Anti-SUMF1 Antibody 100 μg 369 € abbex human
AR50126PU-N anti-SUMF1 / FGE (91-374, His-tag) Antibody 0,25 mg 1109 € acr human
AR50126PU-S anti-SUMF1 / FGE (91-374, His-tag) Antibody 50 Вµg 485 € acr human
AP54107PU-N anti-SUMF1 / FGE (C-term) Antibody 0,4 ml 587 € acr human
GENTAUR-58be5c7c325d0 Anti-SUMF1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx935660 Anti-SUMF1 siRNA 15 nmol 528 € abbex human
abx935661 Anti-SUMF1 siRNA 15 nmol 528 € abbex human
MBS421893 Goat anti-SUMF1 Antibody 100ug 370 € MBS Polyclonals_1 human
GWB-MX093C SUMF1 antibody 1 vial 521 € genways human
R34022-100UG SUMF1 Antibody 0.1mg 406 € NJS poly human
bs-12366R-A350 SUMF1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12366R-A488 SUMF1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12366R-A555 SUMF1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12366R-A594 SUMF1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12366R-A647 SUMF1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12366R-Biotin SUMF1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human