Recombinant Human Cyclophilin C, PPIase C, PPIC (N-Trx, 6His)

Contact us
Catalog number: C215
Price: 869 €
Supplier: DL elisas
Product name: Recombinant Human Cyclophilin C, PPIase C, PPIC (N-Trx, 6His)
Quantity: 96T
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the N-terminus, Recombinant Human Cyclophilin C is produced by our E, coli expression system and the target gene encoding Lys31-Asp182 is expressed with a Trx
Molecular Weight: 33, 78 kD
UniProt number: P45877
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATD
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: 6His), PPIC (N-Trx, PPIase C, Cyclophilin C
Short name: 6His), PPIC (N-Trx, PPIase C, Recombinant Cyclophilin C
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: 6His), PPIase C, peptidylprolyl isomerase C (cyclophilin C) (N-Trx, sapiens Cyclophilin C, recombinant H
Alternative technique: rec
Alternative to gene target: CYPC, Cytoplasm, PPIC and IDBG-39025 and ENSG00000168938 and 5480, PPIC and IDBG-644954 and ENSBTAG00000001568 and 535494, Ppic and IDBG-147010 and ENSMUSG00000024538 and 19038, this GO :0000413 and protein peptidyl-prolyl isomerization and biological process this GO :0003755 and peptidyl-prolyl cis-trans isomerase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0006457 and protein folding and biological process this GO :0007165 and signal transduction and biological process this GO :0016018 and cyclosporin A binding and molecular function this GO :0051082 and unfolded protein binding and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity, this GO :0003755 : peptidyl-prolyl cis-trans isomerase activity and also this GO :0005515 : protein binding and also this GO :0016018 : cyclosporin A binding and also this GO :0051082 : unfolded protein binding, this GO :0005515 : protein binding, this GO :0016018 : cyclosporin A binding, this GO :0051082 : unfolded protein binding, unfolded protein binding, peptidylprolyl isomerase C (cyclophilin C)
Identity: 9256
Gene: PPIC | More about : PPIC
Long gene name: peptidylprolyl isomerase C
Synonyms: CYPC
Synonyms name: cyclophilin C
Locus: 5q23, 2
Discovery year: 1993-06-18
GenBank acession: S71018
Entrez gene record: 5480
Pubmed identfication: 1383094 8031755
RefSeq identity: NM_000943
Classification: Cyclophilin peptidylprolyl isomerases
Havana BLAST/BLAT: OTTHUMG00000128921

Related Products :

C215 Recombinant Human Cyclophilin C, PPIase C, PPIC (N-Trx, 6His) 10 µg 202 € novo human
C216 Recombinant Human Cyclophilin E, PPIase E, PPIE (N-6His) 10 µg 202 € novo human
CE96 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase D, PPID, PPIase D (N, C-6His) 500 µg 1613 € novo human
C291 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase-Like 1, PPIase, PPIL1(N-6His) 500 µg 1613 € novo human
GENTAUR-58bde83549e20 Mouse Monoclonal [clone AT3C6] (IgG2b,k) to Human PPIC / Cyclophilin C Antibody 0.05 ml 597 € MBS mono human
CF13 Recombinant Human B-Cell Differentiation Antigen CD72, Lyb‑2 (N-Trx, 6His) 10 µg 202 € novo human
CG65 Recombinant Human Endoglin, CD105 (N-Trx, 6His) 500 µg 1613 € novo human
C279 Recombinant Human Hydroxyacid Oxidase 1, HAO1 (N-Trx, 6His) 10 µg 202 € novo human
CE54 Recombinant Human Serpin B6, Placental Thrombin Inhibitor (N-Trx, 6His) 50 µg 496 € novo human
CG82 Recombinant Human Sterol O-Acyltransferase 2, SOAT2, ACAT2 (N-Trx, 6His) 50 µg 496 € novo human
RP-1242H Recombinant Human PPIase / FKBP7 Protein (Fc Tag) 20μg 572 € adv human
RP-1241H Recombinant Human PPIase / FKBP7 Protein (His Tag) 20μg 572 € adv human
AP55142SU-N anti-Peptidyl-prolyl cis-trans isomerase A (PPIA/PPIase 1) Antibody 0,2 ml 630 € acr human
GENTAUR-58be20a8508b5 Anti-PPIase Antibody 100ul 542 € MBS mono human
MBS624484 FKBP14, NT (FK506-binding Protein 14, Peptidyl-prolyl Cis-trans Isomerase FKBP14, PPIase FKBP14, Rotamase, 22kD FK506-binding Protein, 22kD FKBP, FKBP-2, FKBP-22, FKBP22, FKBP-14, UNQ322/PRO381) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS619128 FKBP4 (FK506 Binding Protein 4, 59kD, FK506 binding protein 4, FKBP52, FKBP59, HBI, Hsp56, PPIase, p52, HSP binding immunophilin, T-cell FK506-binding protein, peptidylprolyl cis-trans isomerase, rotamase) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS623609 FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52) Antibody 200ul 603 € MBS Polyclonals_1 human
GENTAUR-58be4c14bb413 PPIase Antibody 100ug 442 € MBS mono human
GENTAUR-58be4c56e6279 PPIase Antibody 100ug 442 € MBS mono human
GENTAUR-58bdad18ee3ba Rickettsia bellii Parvulin-like PPIase (plp) 100ug 1779 € MBS Recombinant Proteins human
GENTAUR-58bdad19674b3 Rickettsia bellii Parvulin-like PPIase (plp) 1000ug 1779 € MBS Recombinant Proteins human
GENTAUR-58bdad19b10ac Rickettsia bellii Parvulin-like PPIase (plp) 100ug 2293 € MBS Recombinant Proteins human
GENTAUR-58bdad1a0b45c Rickettsia bellii Parvulin-like PPIase (plp) 1000ug 2293 € MBS Recombinant Proteins human
THRX25-R Purified Recombinant (E coli, >95%) Human Thioredoxin 2 (Trx2/Mitochodrial/Mt-Trx) protein 25 μg 304 € adi human
CG47 Recombinant Human ATP-binding Cassette B5, ABCB5 (N-Trx) 10 µg 202 € novo human
RP-0126H Recombinant Human BCL6 / B-cell CLL lymphoma 6 Protein (aa 1-150, His & Trx Tag) 50μg 572 € adv human
RP-1441H Recombinant Human SOCS3 / CIS3 Protein (His & Trx Tag) 20μg 572 € adv human
abx571754 Anti-Human Peptidylprolyl Isomerase C (PPIC) ELISA Kit inquire 50 € abbex human
abx152809 Anti-Human PPIC ELISA Kit inquire 50 € abbex human
DL-PPIC-Hu Human Peptidylprolyl Isomerase C PPIC ELISA Kit 96T 869 € DL elisas human