| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Stratifin is produced by our E, coli expression system and the target gene encoding Met1-Ser248 is expressed |
| Molecular Weight: |
27, 77 kD |
| UniProt number: |
P31947 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
1 mM DTT, 1 mM EDTA, 250 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
SFN, Stratifin |
| Short name: |
SFN, Recombinant Stratifin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
sapiens Stratifin, stratifin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
SFN and IDBG-647781 and ENSBTAG00000009223 and 528453, SFN and IDBG-94738 and ENSG00000175793 and 2810, Sfn and IDBG-195282 and ENSMUSG00000047281 and 55948, YWHAS, nuclei, phosphoprotein binding, this GO :0000079 and regulation of cyclin-dependent protein serine/threonine kinase activity and biological process this GO :0001836 and release of cytochrome c from mitochondria and biological process this GO :0003334 and keratinocyte development and biological process this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006469 and negative regulation of protein kinase activity and biological process this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0008426 and protein kinase C inhibitor activity and molecular function this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0010482 and regulation of epidermal cell division and biological process this GO :0010839 and negative regulation of keratinocyte proliferation and biological process this GO :0019901 and protein kinase binding and molecular function this GO :0019904 and protein domain specific binding and molecular function this GO :0030216 and keratinocyte differentiation and biological process this GO :0030307 and positive regulation of cell growth and biological process this GO :0030659 and cytoplasmic vesicle membrane and cellular component this GO :0031424 and keratinization and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043588 and skin development and biological process this GO :0045606 and positive regulation of epidermal cell differentiation and biological process this GO :0046827 and positive regulation of protein export from nucleus and biological process this GO :0051219 and phosphoprotein binding and molecular function this GO :0051726 and regulation of cell cycle and biological process this GO :0061024 and membrane organization and biological process this GO :0061436 and establishment of skin barrier and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071901 and negative regulation of protein serine/threonine kinase activity and biological process this GO :0097193 and intrinsic apoptotic signaling pathway and biological process this GO :1900740 and positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008426 : protein kinase C inhibitor activity and also this GO :0019901 : protein kinase binding and also this GO :0019904 : protein domain specific binding and also this GO :0051219 : phosphoprotein binding, this GO :0008426 : protein kinase C inhibitor activity, this GO :0019901 : protein kinase binding, this GO :0019904 : protein domain specific binding, this GO :0051219 : phosphoprotein binding, stratifin |
| Identity: |
10773 |
| Gene: |
SFN |
More about : SFN |
| Long gene name: |
stratifin |
| Synonyms: |
YWHAS |
| Synonyms name: |
14-3-3 sigma |
| Locus: |
1p36, 11 |
| Discovery year: |
1994-09-15 |
| GenBank acession: |
BC023552 |
| Entrez gene record: |
2810 |
| Pubmed identfication: |
8515476 |
| RefSeq identity: |
NM_006142 |
| Classification: |
14-3-3 phospho-serine/phospho-threonine binding proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000004093 |