Recombinant Human Stratifin, SFN

Contact us
Catalog number: C173
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Stratifin, SFN
Quantity: inquire
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Stratifin is produced by our E, coli expression system and the target gene encoding Met1-Ser248 is expressed
Molecular Weight: 27, 77 kD
UniProt number: P31947
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, 1 mM EDTA, 250 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SFN, Stratifin
Short name: SFN, Recombinant Stratifin
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: sapiens Stratifin, stratifin, recombinant H
Alternative technique: rec
Alternative to gene target: SFN and IDBG-647781 and ENSBTAG00000009223 and 528453, SFN and IDBG-94738 and ENSG00000175793 and 2810, Sfn and IDBG-195282 and ENSMUSG00000047281 and 55948, YWHAS, nuclei, phosphoprotein binding, this GO :0000079 and regulation of cyclin-dependent protein serine/threonine kinase activity and biological process this GO :0001836 and release of cytochrome c from mitochondria and biological process this GO :0003334 and keratinocyte development and biological process this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006469 and negative regulation of protein kinase activity and biological process this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0008426 and protein kinase C inhibitor activity and molecular function this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0010482 and regulation of epidermal cell division and biological process this GO :0010839 and negative regulation of keratinocyte proliferation and biological process this GO :0019901 and protein kinase binding and molecular function this GO :0019904 and protein domain specific binding and molecular function this GO :0030216 and keratinocyte differentiation and biological process this GO :0030307 and positive regulation of cell growth and biological process this GO :0030659 and cytoplasmic vesicle membrane and cellular component this GO :0031424 and keratinization and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043588 and skin development and biological process this GO :0045606 and positive regulation of epidermal cell differentiation and biological process this GO :0046827 and positive regulation of protein export from nucleus and biological process this GO :0051219 and phosphoprotein binding and molecular function this GO :0051726 and regulation of cell cycle and biological process this GO :0061024 and membrane organization and biological process this GO :0061436 and establishment of skin barrier and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071901 and negative regulation of protein serine/threonine kinase activity and biological process this GO :0097193 and intrinsic apoptotic signaling pathway and biological process this GO :1900740 and positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008426 : protein kinase C inhibitor activity and also this GO :0019901 : protein kinase binding and also this GO :0019904 : protein domain specific binding and also this GO :0051219 : phosphoprotein binding, this GO :0008426 : protein kinase C inhibitor activity, this GO :0019901 : protein kinase binding, this GO :0019904 : protein domain specific binding, this GO :0051219 : phosphoprotein binding, stratifin
Identity: 10773
Gene: SFN | More about : SFN
Long gene name: stratifin
Synonyms: YWHAS
Synonyms name: 14-3-3 sigma
Locus: 1p36, 11
Discovery year: 1994-09-15
GenBank acession: BC023552
Entrez gene record: 2810
Pubmed identfication: 8515476
RefSeq identity: NM_006142
Classification: 14-3-3 phospho-serine/phospho-threonine binding proteins
Havana BLAST/BLAT: OTTHUMG00000004093

Related Products :

C173 Recombinant Human Stratifin, SFN 50 µg 369 € novo human
MBS244338 Anti-Human SFN / Stratifin / 14-3-3 Sigma Antibody 50ug 597 € MBS Polyclonals_1 human
abx572396 Anti-Human Stratifin (SFN) ELISA Kit 96 tests 789 € abbex human
MBS247960 Goat Polyclonal to Human SFN / Stratifin / 14-3-3 Sigma Antibody 50ug 597 € MBS Polyclonals_1 human
DL-SFN-Hu Human Stratifin SFN ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bde7c407677 Mouse Monoclonal [clone 3C3] (IgG1,k) to Human SFN / Stratifin / 14-3-3 Sigma Antibody 50ug 663 € MBS mono human
GENTAUR-58bdc265024ea Anti- Stratifin (SFN) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdca1e704e3 Anti- Stratifin (SFN) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdca1f15e03 Anti- Stratifin (SFN) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd4c4cc8df Anti- Stratifin (SFN) Antibody 100ug 564 € MBS Polyclonals human
MBS244926 PAb (IgG) to Sheep SFN / Stratifin / 14-3-3 Sigma Antibody 0.05 ml 597 € MBS Polyclonals_1 sheep
EKU07476 Stratifin (SFN) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
abx153184 Anti-Human Stratifin ELISA Kit inquire 50 € abbex human
MBS421444 Goat anti-14-3-3 sigma / Stratifin Antibody 100ug 370 € MBS Polyclonals_1 human
AR09318PU-L anti-14-3-3 protein sigma / SFN (1-248) Antibody 0,5 mg 1022 € acr human
AR09318PU-N anti-14-3-3 protein sigma / SFN (1-248) Antibody 0,1 mg 413 € acr human
AM20889PU-N anti-14-3-3 protein sigma / SFN Antibody 50 Вµg 819 € acr human
AP05570SU-N anti-14-3-3 protein sigma / SFN Antibody 0,1 ml 703 € acr human
AP54746SU-N anti-14-3-3 protein sigma / SFN Antibody 0,2 ml 630 € acr human
BB-PA1797 anti-14-3-3 protein sigma / SFN Antibody 0,1 mg 471 € acr human
AP33512PU-N anti-14-3-3 protein sigma / SFN (C-term) Antibody 0,4 ml 601 € acr human
AP22876SU-N anti-14-3-3 protein sigma / SFN (N-term) Antibody 50 Вµl 732 € acr human
AP54745SU-N anti-14-3-3 protein sigma / SFN pSer248 Antibody 0,2 ml 630 € acr human
GENTAUR-58bdf9b268620 Anti- SFN Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf9b2c1768 Anti- SFN Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be005936c57 Anti- SFN Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be005999d97 Anti- SFN Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3d939165d Anti- SFN Antibody 100ug 393 € MBS Polyclonals human
abx218543 Anti-SFN Antibody 200 μg 369 € abbex human
abx933104 Anti-SFN siRNA inquire 50 € abbex human