Recombinant Human C-C Motif Chemokine 26, CCL26 (27-94)

Contact us
Catalog number: C114
Price: 1298 €
Supplier: novo
Product name: Recombinant Human C-C Motif Chemokine 26, CCL26 (27-94)
Quantity: 500 µg
Other quantities: 10 µg 179€ 50 µg 440€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 21 kD, 8
UniProt number: Q9Y258
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CCL26 (27-94), C-C Motif Chemokine 26
Short name: CCL26 (27-94), Recombinant C-C Motif Chemokine 26
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: chemokine (C-C motif) ligand 26 (27-94), sapiens C-C Motif Chemokine 26, recombinant H
Alternative technique: rec
Alternative to gene target: CCL16 and IDBG-630591 and ENSBTAG00000007193 and 616732, CCL26 and IDBG-22717 and ENSG00000006606 and 10344, Ccl26 and IDBG-203924 and ENSMUSG00000070464 and 541307, Extracellular, IMAC and MIP-4a and MIP-4alpha and SCYA26 and TSC-1, chemokine activity, this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0030335 and positive regulation of cell migration and biological process this GO :0030838 and positive regulation of actin filament polymerization and biological process this GO :0032855 and positive regulation of Rac GTPase activity and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity, chemokine (C-C motif) ligand 26
Identity: 10625
Gene: CCL26 | More about : CCL26
Long gene name: C-C motif chemokine ligand 26
Synonyms gene: SCYA26
Synonyms gene name: member 26 chemokine (C-C motif) ligand 26 , small inducible cytokine subfamily A (Cys-Cys)
Synonyms: MIP-4alpha eotaxin-3 IMAC MIP-4a TSC-1
Synonyms name: macrophage inflammatory protein 4-alpha small inducible cytokine A26 CC chemokine IMAC chemokine N1 thymic stroma chemokine-1 eotaxin-3
Locus: 7q11, 23
Discovery year: 1999-06-09
GenBank acession: AF124601
Entrez gene record: 10344
Pubmed identfication: 10373330
RefSeq identity: NM_006072
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000130403

Related Products :

MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
C113 Recombinant Human C-C Motif Chemokine 26, CCL26 (24-94) 1 mg 1836 € novo human
C114 Recombinant Human C-C Motif Chemokine 26, CCL26 (27-94) 50 µg 440 € novo human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58be31bbb4dcf CCR8, loop2 (chemokine receptor 8, C-C chemokine receptor type 8, CC-CKR-8, C-C CKR-8, CCR-8, CDw198, Chemokine receptor-like 1, CKRL1) Antibody 100ul 707 € MBS mono human
MBS611205 LEC, NCC-4 (Liver-Expressed Chemokine, New Chemokine CC-4, Small Inducible Cytokine Subfamily A (Cys X Cys) member 16, SCYA16, IL-10-inducible Chemokine, Monotactin-1) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS619083 BCA-1 (B Cell Attracting Chemokine 1, BCA1, B Lymphocyte Chemoattractant, ANGIE, ANGIE2, BLC, BLR1 Ligand, BLR1L, Chemokine (C-X-C Motif) Ligand 13 (B-cell Chemoattractant), C-X-C Motif Chemokine 13, CXCL13, CXC Chemokine BLC, Small Inducible Cytokine B S Antibody 50ug 774 € MBS Polyclonals_1 human
MBS623554 CCR7 (C-C Chemokine Receptor Type 7, Chemokine (C-C Motif) Receptor 7, C-C CKR-7, CC-CKR-7, CCR-7, BLR2, CD197, CDw197, CMKBR7, Epstein-Barr Virus-induced G-protein Coupled Receptor 1, EBV Induced G Protein Coupled Receptor 1, EBI1, EVI1, MIP-3 beta Recep Antibody 100ug 619 € MBS Polyclonals_1 virus
MBS622999 TRIM3 (Tripartite Motif Containing 3, Tripartite Motif-containing 3, Tripartite Motif Protein TRIM3, Brain Expressed Ring Finger, Brain-expressed Ring Finger, BERP, HAC1, Ring Finger Protein 22, RNF22, Ring Finger Protein 97, RNF97) 100ug 785 € MBS Polyclonals_1 human
MBS621891 TRIM56 (Tripartite Motif Containing 56, Tripartite Motif-containing 56, Tripartite Motif Containing Protein 56, DKFZp667O116, A130009K11Rik, FLJ35608, Gm452, MGC37358, OTTMUSP00000027392, RING Finger Protein 109, RNF109) 100ul 785 € MBS Polyclonals_1 human
C094 Recombinant Human C-C Motif Chemokine 1, CCL1 500 µg 1613 € novo human
CF47 Recombinant Human C-C Motif Chemokine 11, CCL11, Eotaxin 50 µg 339 € novo human
C439 Recombinant Human C-C Motif Chemokine 14, CCL14, HCC-3 (C-6His) 10 µg 156 € novo human
C064 Recombinant Human C-C Motif Chemokine 16, CCL16 50 µg 405 € novo human
C599 Recombinant Human C-C motif chemokine 17, CCL17 (C-6His) 10 µg 126 € novo human
CF38 Recombinant Human C-C Motif Chemokine 18, CCL18, PARC (N-6His) 10 µg 202 € novo human
CM78 Recombinant Human C-C Motif Chemokine 2, CCL2, MCP-1 500 µg 1755 € novo human
C090 Recombinant Human C-C Motif Chemokine 23, CCL23 10 µg 168 € novo human
CC43 Recombinant Human C-C Motif Chemokine 24, CCL24, Eotaxin-2, MPIF-2 (C-6His) 1 mg 2283 € novo human
C065 Recombinant Human C-C Motif Chemokine 27, CCL27 10 µg 168 € novo human
C095 Recombinant Human C-C Motif Chemokine 28, CCL28 500 µg 1298 € novo human