| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
53 kD, 8 |
| UniProt number: |
Q9Y258 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
1 mM EDTA, 20% Glycerol, pH 9, 2 um filtered solution of 20 mM Tris, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MTRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CCL26 (24-94), C-C Motif Chemokine 26 |
| Short name: |
CCL26 (24-94), Recombinant C-C Motif Chemokine 26 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
chemokine (C-C motif) ligand 26 (24-94), sapiens C-C Motif Chemokine 26, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CCL16 and IDBG-630591 and ENSBTAG00000007193 and 616732, CCL26 and IDBG-22717 and ENSG00000006606 and 10344, Ccl26 and IDBG-203924 and ENSMUSG00000070464 and 541307, Extracellular, IMAC and MIP-4a and MIP-4alpha and SCYA26 and TSC-1, chemokine activity, this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008009 and chemokine activity and molecular function this GO :0030335 and positive regulation of cell migration and biological process this GO :0030838 and positive regulation of actin filament polymerization and biological process this GO :0032855 and positive regulation of Rac GTPase activity and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity, chemokine (C-C motif) ligand 26 |
| Identity: |
10625 |
| Gene: |
CCL26 |
More about : CCL26 |
| Long gene name: |
C-C motif chemokine ligand 26 |
| Synonyms gene: |
SCYA26 |
| Synonyms gene name: |
member 26 chemokine (C-C motif) ligand 26 , small inducible cytokine subfamily A (Cys-Cys) |
| Synonyms: |
MIP-4alpha eotaxin-3 IMAC MIP-4a TSC-1 |
| Synonyms name: |
macrophage inflammatory protein 4-alpha small inducible cytokine A26 CC chemokine IMAC chemokine N1 thymic stroma chemokine-1 eotaxin-3 |
| Locus: |
7q11, 23 |
| Discovery year: |
1999-06-09 |
| GenBank acession: |
AF124601 |
| Entrez gene record: |
10344 |
| Pubmed identfication: |
10373330 |
| RefSeq identity: |
NM_006072 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000130403 |