| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
12, 49 kD |
| UniProt number: |
Q9NRJ3 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CCL28, C-C Motif Chemokine 28 |
| Short name: |
CCL28, Recombinant C-C Motif Chemokine 28 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
chemokine (C-C motif) ligand 28, sapiens C-C Motif Chemokine 28, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CCL28 and IDBG-19270 and ENSG00000151882 and 56477, CCL28 and IDBG-629570 and ENSBTAG00000001557 and 535328, Ccl28 and IDBG-705098 and ENSMUSG00000074715 and 56838, Extracellular, chemokine activity, this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006955 and immune response and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007584 and response to nutrient and biological process this GO :0008009 and chemokine activity and molecular function this GO :0060326 and cell chemotaxis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0008009 : chemokine activity, this GO :0008009 : chemokine activity, chemokine (C-C motif) ligand 28 |
| Identity: |
17700 |
| Gene: |
CCL28 |
More about : CCL28 |
| Long gene name: |
C-C motif chemokine ligand 28 |
| Synonyms gene name: |
chemokine (C-C motif) ligand 28 |
| Synonyms: |
SCYA28 MEC CCK1 |
| Synonyms name: |
CC chemokine CCL28 mucosae-associated epithelial chemokine small inducible cytokine subfamily A (Cys-Cys), member 28 small inducible cytokine A28 |
| Locus: |
5p12 |
| Discovery year: |
2002-08-22 |
| GenBank acession: |
AF110384 |
| Entrez gene record: |
56477 |
| Pubmed identfication: |
10781587 11295038 |
| RefSeq identity: |
NM_148672 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000094811 |