| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ETV4 / PEA3 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the ETV4 antibody should be determined by the researcher |
| Intented use: |
This ETV4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P43268 |
| Purity: |
Antigen affinity |
| Description: |
E1AF can activate the promoters of various matrix metalloproteinases, It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene, It is mapped to 17q21, Pea3 is detected in cells of epithelial and fibroblastic origin, also known as polyoma enhancer activator 3 (PEA3), by 10 to 20 fold, genes whose expression is associated with tumor cell invasion and metastasis, is a member of the PEA3 subfamily of Ets transcription factors, or E1AF, 31, ETS translocation variant 4 (ETV4) |
| Immunogen: |
Amino acids MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD of human PEA3/ETV4 were used as the immunogen for the ETV4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ETV4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ETV4 / PEA3 |
| Short name: |
ETV4 Antibody / PEA3 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
ETV4 (Antibody to) / PEA3 |
| Alternative technique: |
antibodies |
| Identity: |
3493 |
| Gene: |
ETV4 |
More about : ETV4 |
| Long gene name: |
ETS variant 4 |
| Synonyms gene name: |
E1AF) , ets variant gene 4 (E1A enhancer-binding protein |
| Synonyms: |
E1A-F E1AF PEA3 |
| Synonyms name: |
E1A enhancer binding protein |
| Locus: |
17q21, 31 |
| Discovery year: |
1995-03-27 |
| GenBank acession: |
U18018 |
| Entrez gene record: |
2118 |
| Pubmed identfication: |
8530053 1547944 |
| RefSeq identity: |
NM_001986 |
| Classification: |
ETS transcription factor family |
| Havana BLAST/BLAT: |
OTTHUMG00000180884 |