ETV4 Antibody / PEA3

Contact us
Catalog number: R32103
Price: 304 €
Supplier: MBS Polyclonals
Product name: ETV4 Antibody / PEA3
Quantity: 50ug
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ETV4 / PEA3
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the ETV4 antibody should be determined by the researcher
Intented use: This ETV4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P43268
Purity: Antigen affinity
Description: E1AF can activate the promoters of various matrix metalloproteinases, It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene, It is mapped to 17q21, Pea3 is detected in cells of epithelial and fibroblastic origin, also known as polyoma enhancer activator 3 (PEA3), by 10 to 20 fold, genes whose expression is associated with tumor cell invasion and metastasis, is a member of the PEA3 subfamily of Ets transcription factors, or E1AF, 31, ETS translocation variant 4 (ETV4)
Immunogen: Amino acids MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD of human PEA3/ETV4 were used as the immunogen for the ETV4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ETV4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ETV4 / PEA3
Short name: ETV4 Antibody / PEA3
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: ETV4 (Antibody to) / PEA3
Alternative technique: antibodies
Identity: 3493
Gene: ETV4 | More about : ETV4
Long gene name: ETS variant 4
Synonyms gene name: E1AF) , ets variant gene 4 (E1A enhancer-binding protein
Synonyms: E1A-F E1AF PEA3
Synonyms name: E1A enhancer binding protein
Locus: 17q21, 31
Discovery year: 1995-03-27
GenBank acession: U18018
Entrez gene record: 2118
Pubmed identfication: 8530053 1547944
RefSeq identity: NM_001986
Classification: ETS transcription factor family
Havana BLAST/BLAT: OTTHUMG00000180884

Related Products :

AM20395SU-N anti-ETV4 / PEA3 (50-109) Antibody 50 Вµl 732 € acr human
AM06250SU-N anti-ETV4 / PEA3 Antibody 0,1 ml 688 € acr human
C10614-1 anti-ETV4 / PEA3 Antibody 50 Вµg 347 € acr human
C10614-2 anti-ETV4 / PEA3 Antibody 0,1 mg 500 € acr human
AP17352PU-N anti-ETV4 / PEA3 (C-term) Antibody 0,4 ml 587 € acr human
R32103 ETV4 Antibody / PEA3 0.1mg 406 € NJS poly human
GENTAUR-58bde6e315f01 Mouse Monoclonal [clone 1A2G3] (IgG1) to Human PEA3 / ETV4 Antibody 0.05 ml 597 € MBS mono human
MBS271884 PEA3 antibody 100ul 426 € MBS Polyclonals_1 human
bs-1869R-A350 PEA3 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1869R-A488 PEA3 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1869R-A555 PEA3 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1869R-A594 PEA3 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1869R-A647 PEA3 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1869R-Biotin PEA3 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1869R PEA3 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-1869R-Cy3 PEA3 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1869R-Cy5 PEA3 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1869R-Cy5.5 PEA3 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1869R-Cy7 PEA3 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1869R-FITC PEA3 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1869R-HRP PEA3 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
MBS276206 PEA3 antibody [N3C3] 100ul 426 € MBS Polyclonals_1 human
GENTAUR-58be5fe735190 Anti-PEA3 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
A02E0142 anti-ETV4 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdeed0c6a65 Anti- ETV4 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdeed141e00 Anti- ETV4 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0a1dae7d7 Anti- ETV4 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0a1e05ebe Anti- ETV4 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be4b7f57220 Anti- ETV4 Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be4e9d10403 Anti- ETV4 Antibody 50ug 304 € MBS Polyclonals human