Keratocan Antibody

Catalog number:	R31830 Buy Now
Price:	1956 €
Supplier:	MBS Recombinant Proteins
Product name:	Keratocan Antibody
Quantity:	1000ug
Other quantities:	0.1ml 263€
Related search:	keratocan antibody gene antibodies proteoglycan synonyms identity

More details Need more?:

Category:	Antibody
Concentration:	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form:	Antigen affinity purified
Conjugation:	Unconjugated
Clone:	Polyclonal antibody
Recognised antigen:	Keratocan
Host animal:	Rabbit (Oryctolagus cuniculus)
Clonality:	Polyclonal (rabbit origin)
Species reactivity:	Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications:	WB
Recommended dilutions:	1-0, 5ug/ml, Western blot: 0
Notes:	Optimal dilution of the Keratocan antibody should be determined by the researcher
Intented use:	This Keratocan antibodyis to be used only for research purposes and not for diagnostics
Uniprot #:	O60938
Purity:	Antigen affinity
Description:	Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2), It is mapped to 12q22, KSPGs, Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family, The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency, also known as keratan sulfate proteoglycan keratocan, are important to the transparency of the cornea, is a protein that in humans is encoded by the KERA gene, lumican and mimecan, particularly keratocan, Keratocan (KTN)
Immunogen:	Amino acids YLQNNLIETIPEKPFENATQLRWINLNKNKITN of human Keratocan were used as the immunogen for the Keratocan antibody
Storage:	Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Keratocan antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties:	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target:	Keratocan
Short name:	Keratocan Antibody
Technique:	antibodies against human proteins, antibodies for, Antibody
Alternative name:	Keratocan (Antibody to)
Alternative technique:	antibodies
Identity:	6309
Gene:	KERA | More about : KERA
Long gene name:	keratocan
Synonyms gene:	CNA2
Synonyms:	SLRR2B
Synonyms name:	keratocan proteoglycan
Locus:	12q21, 33
Discovery year:	1999-08-26
GenBank acession:	AF063301
Entrez gene record:	11081
Pubmed identfication:	10565548 10802664
RefSeq identity:	NM_007035
Classification:	Small leucine rich repeat proteoglycans
Havana BLAST/BLAT:	OTTHUMG00000170073
Locus Specific Databases:	LRG_538

• #keratocan
• #antibody
• #gene
• #antibodies
• #proteoglycan
• #synonyms
• #identity