Recombinant Human Bcl-2-like Protein 11, BIML (N-6His)

Contact us
Catalog number: CR24
Price: 223 €
Supplier: accurate-monoclonals
Product name: Recombinant Human Bcl-2-like Protein 11, BIML (N-6His)
Quantity: 0.1000ul
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Bcl-2-like Protein 11 is produced by our E, coli expression system and the target gene encoding Met1-Arg120 is expressed with a 6His tag at the N-terminus
Molecular Weight: 15 kD
UniProt number: O43521-2
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 10% glycerol, 150 mM sodium chloride, 2 mM DTT, pH8, 2 um filtered solution of 20 mM HEPES, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: BIML (N-6His), Bcl-2-like Protein 11
Short name: BIML (N-6His), Recombinant Bcl-2-like Protein 11
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: BIML (N-6His), sapiens Bcl-2-like Protein 11, recombinant H
Alternative technique: rec
Identity: 994
Gene: BCL2L11 | More about : BCL2L11
Long gene name: BCL2 like 11
Synonyms gene name: BCL2-like 11 (apoptosis facilitator)
Synonyms: BOD BimL BimEL BimS BIM
Locus: 2q13
Discovery year: 1999-12-10
GenBank acession: AF032458
Entrez gene record: 10018
Pubmed identfication: 9731710 9430630
Classification: BCL2 homology region 3 (BH3) only
Havana BLAST/BLAT: OTTHUMG00000131256
Locus Specific Databases: LRG_620

Related Products :

CR24 Recombinant Human Bcl-2-like Protein 11, BIML (N-6His) 10 µg 202 € novo human
MBS624587 Bad, BH3 Domain (Bcl2 Antagonist Of Cell Death, BAD, Bcl-2-binding Component 6, Bcl-XL/Bcl-2-Associated Death Promoter, Bcl-2-like 8 Protein, BAD, BBC6, BCL2L8) Antibody 200ul 597 € MBS Polyclonals_1 human
OBT1663 BimLong (BIML), Clone: 5E5, Rat Mouse Monoclonal antibody-Human, Mouse; WB/flow/IH/IP 50 ug Ask price € accurate-monoclonals mouse
YSRTMCA1827 BimL, Clone: 5E5, Rat Mouse Monoclonal antibody-; frozen, IH/flow/IP/WB 0.1 mg Ask price € accurate-monoclonals mouse
MBS621291 Bcl 2-Related Protein A1 (Bcl 2 Related Protein A1, Bcl-2-related Protein A1, ACC-1, ACC-2, BCL2L5, BFL1, BFL-1, GRS, Hematopoietic Bcl2-related Protein A1, HBPA1, Hemopoietic-specific Early Response Protein, Protein BFL-1, Protein GRS) Antibody 50ug 724 € MBS Polyclonals_1 human
CF02 Recombinant Human BAX, Bcl-2-Like Protein 4, BCL2L4 (N, C-6His) 1 mg 2486 € novo human
C104 Recombinant Human Bcl-2-Like Protein 1, BCL2L1 (C-6His) 50 µg 369 € novo human
MBS623426 Bak, BH3 Domain (Bcl-2 Homologous Antagonist/Killer, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7, BAK1, BCL2L7, CDN1) Antibody 200ul 603 € MBS Polyclonals_1 human
AM08172BT-N anti-Bcl-2-like 1 (Bcl-xL) Antibody 0,1 mg 645 € acr human
AM08172FC-N anti-Bcl-2-like 1 (Bcl-xL) Antibody 0,1 mg 688 € acr human
AM08172PU-N anti-Bcl-2-like 1 (Bcl-xL) Antibody 0,1 mg 674 € acr human
AM08172RP-N anti-Bcl-2-like 1 (Bcl-xL) Antibody 0,1 mg 761 € acr human
AP00094PU-N anti-Bcl-2-like 1 (Bcl-xL) Antibody 0,1 mg 645 € acr human
AP05005PU-N anti-Bcl-2-like 1 (Bcl-xL) Antibody 0,1 mg 587 € acr human
AP06029PU-N anti-Bcl-2-like 1 (Bcl-xL) Antibody 0,1 mg 558 € acr human
AP06498PU-N anti-Bcl-2-like 1 (Bcl-xL) Antibody 0,1 mg 558 € acr human
AP01538PU-N anti-Bcl-2-like 1 (Bcl-xLSer62) Antibody 0,1 mg 558 € acr human
AP23387PU-N anti-Bcl-2-like 1 (Bcl-xS) Antibody 0,1 mg 543 € acr human
C105 Recombinant Human Bcl-2-Llike Protein 2, BCL2L2 (C-6His) 500 µg 1613 € novo human
C103 Recombinant Human Bcl-2 Related Protein A1, BCL2A1 (C-6His) 1 mg 2283 € novo human
CR22 Recombinant Human Apoptosis Regulator Bcl-2 (C-6His) 500 µg 1186 € novo human
CE40 Recombinant Human Bcl-2-Associated Athanogene 1, BAG2 (N-6His) 1 mg 2283 € novo human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
MEDCLA826 bcl-10 (Oncogene protein), Clone: bcl-DAA22, Mouse Monoclonal antibody-Human; frozen/NO paraffin, IH/WB 1000ul 1034 € accurate-monoclonals human
BYA9535-1 bcl-2 (Oncogene protein), 26kD, Clone: Bcl-2-100, Mouse Monoclonal antibody-Human (NO X w/Mouse); frozen/paraffin 500ul Ask price € accurate-monoclonals mouse
MEDCLA685 bcl-2 (Oncogene protein), Clone: bcl-2/100/D5, Mouse Monoclonal antibody-Human; frozen/paraffin, IH 7 ml Ask price € accurate-monoclonals human
MEDCLA686 bcl-2 (Oncogene protein), Clone: bcl-2/100/D5, Mouse Monoclonal antibody-Human; frozen/paraffin, IH 12 ml Ask price € accurate-monoclonals human
MEDCLA726 bcl-2 (Oncogene protein), Clone: bcl-2/100/D5, Mouse Monoclonal antibody-Human; frozen/paraffin, IH/WB 1000ul Ask price € accurate-monoclonals human
MEDORG100 bcl-2, Clone: bcl-2/100/D5, Mouse Monoclonal antibody-Human; paraffin, IHC 50 tests 777 € accurate-monoclonals human
MEDCLA005-01 bcl-2 Oncoprotein, Clone: bcl-2/100/D5, Mouse Monoclonal antibody-Human; paraffin, IHC 0.1000ul 223 € accurate-monoclonals human