Recombinant Human Peptidyl-prolyl Cis-trans Isomerase A, Cyclophilin A, CYPA

Contact us
Catalog number: CR15
Price: 1564 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Peptidyl-prolyl Cis-trans Isomerase A, Cyclophilin A, CYPA
Quantity: 100ug
Other quantities: 1 mg 1014€ 10 µg 80€ 50 µg 141€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Peptidyl-prolyl Cis-trans Isomerase A is produced by our E, coli expression system and the target gene encoding Met1-Glu165 is expressed
Molecular Weight: 18 kD
UniProt number: P62937
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 10%glycerol, pH7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CYPA, Cyclophilin A, Peptidyl-prolyl Cis-trans Isomerase A
Short name: CYPA, Cyclophilin A, Recombinant Peptidyl-prolyl Cis-trans Isomerase A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CYPA, Cyclophilin A, sapiens Peptidyl-prolyl Cis-trans Isomerase A, recombinant H
Alternative technique: rec
Identity: 9253
Gene: PPIA | More about : PPIA
Long gene name: peptidylprolyl isomerase A
Synonyms: CYPA
Synonyms name: cyclophilin A
Locus: 7p13
Discovery year: 1991-12-06
GenBank acession: X52851
Entrez gene record: 5478
Pubmed identfication: 1989998 2197089
RefSeq identity: NM_021130
Classification: Cyclophilin peptidylprolyl isomerases
Havana BLAST/BLAT: OTTHUMG00000023687

Related Products :

CR15 Recombinant Human Peptidyl-prolyl Cis-trans Isomerase A, Cyclophilin A, CYPA 1 mg 1014 € novo human
CR16 Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A, Cyclophilin A, CYPA 500 µg 659 € novo mouse
GENTAUR-58b9e216ad728 Blattella germanica Peptidyl-prolyl cis-trans isomerase (CYPA) 100ug 1531 € MBS Recombinant Proteins human
GENTAUR-58b9e2171e7d4 Blattella germanica Peptidyl-prolyl cis-trans isomerase (CYPA) 1000ug 1531 € MBS Recombinant Proteins human
GENTAUR-58b9e21770ed2 Blattella germanica Peptidyl-prolyl cis-trans isomerase (CYPA) 100ug 2033 € MBS Recombinant Proteins human
GENTAUR-58b9e217d5590 Blattella germanica Peptidyl-prolyl cis-trans isomerase (CYPA) 1000ug 2033 € MBS Recombinant Proteins human
RP-412 Recombinant (E.Coli) Human Peptidyl-Prolyl Cis/Trans Isomerase 5 μg 188 € adi human
CE96 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase D, PPID, PPIase D (N, C-6His) 500 µg 1613 € novo human
CC56 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP2, FKBP22, FKBP13 (C-6His) 10 µg 156 € novo human
CH60 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His) 50 µg 156 € novo human
CG71 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP4, FKBP4 (C-6His) 10 µg 95 € novo human
CA33 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP7, FKBP7 (C-6His) 10 µg 202 € novo human
C253 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase H, PPIH (N-6His) 10 µg 202 € novo human
C291 Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase-Like 1, PPIase, PPIL1(N-6His) 500 µg 1613 € novo human
abx250342 Anti-Human Peptidyl-prolyl cis-trans isomerase FKBP5 ELISA Kit inquire 50 € abbex human
abx250535 Anti-Human Peptidyl-prolyl cis-trans isomerase FKBP8 ELISA Kit 96 tests 659 € abbex human
abx251719 Anti-Human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 ELISA Kit inquire 50 € abbex human
GENTAUR-58bc1dd0dea95 Human Peptidyl-prolyl cis-trans isomerase A (PPIA) 100ug 1536 € MBS Recombinant Proteins human
GENTAUR-58bc1dd13cb00 Human Peptidyl-prolyl cis-trans isomerase A (PPIA) 1000ug 1536 € MBS Recombinant Proteins human
GENTAUR-58bc1dd180c0f Human Peptidyl-prolyl cis-trans isomerase A (PPIA) 100ug 2039 € MBS Recombinant Proteins human
GENTAUR-58bc1dd1c5849 Human Peptidyl-prolyl cis-trans isomerase A (PPIA) 1000ug 2039 € MBS Recombinant Proteins human
GENTAUR-58ba70b227103 Human Peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) 100ug 1940 € MBS Recombinant Proteins human
GENTAUR-58ba70b367a9d Human Peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) 1000ug 1940 € MBS Recombinant Proteins human
GENTAUR-58ba70b3cb2f4 Human Peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) 100ug 2453 € MBS Recombinant Proteins human
GENTAUR-58ba70b4c63f1 Human Peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) 1000ug 2453 € MBS Recombinant Proteins human
GENTAUR-58bafe638091c Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 100ug 1564 € MBS Recombinant Proteins human
GENTAUR-58bafe63eddfd Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 1000ug 1564 € MBS Recombinant Proteins human
GENTAUR-58bafe644de70 Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 100ug 2067 € MBS Recombinant Proteins human
GENTAUR-58bafe64985dc Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 1000ug 2067 € MBS Recombinant Proteins human
GENTAUR-58bb2a84a840c Human Peptidyl-prolyl cis-trans isomerase H (PPIH) 100ug 1564 € MBS Recombinant Proteins human