Recombinant Mouse VSIG4 (C-6His)

Contact us
Catalog number: CP83
Price: 146 €
Supplier: novo
Product name: Recombinant Mouse VSIG4 (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 1674€ 50 µg 303€ 500 µg 1186€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse V-Set and Ig Domain-Containing Protein 4 is produced by our Mammalian expression system and the target gene encoding His20-Pro187 is expressed with a 6His tag at the C-terminus
Molecular Weight: 19, 7 kD
UniProt number: F6TUL9
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRKYNPPRINTEAPTTLHSSLEATTIMSSTSDLTTNGTGKLEETIAGSGRNLPHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: VSIG4 (C-6His)
Short name: Recombinant Mouse VSIG4 (C-6His)
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: recombinant Mouse V-set and immunoglobulin domain containing 4 (C-6His)
Alternative technique: rec
Alternative to gene target: CRIg and Z39IG, Plasma membranes, VSIG4 and IDBG-637672 and ENSBTAG00000015769 and 614262, VSIG4 and IDBG-73541 and ENSG00000155659 and 11326, Vsig4 and IDBG-160903 and ENSMUSG00000044206 and 278180, alternative pathway and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0032703 and negative regulation of interleukin-2 production and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, protein binding, this GO :0005515 and protein binding and molecular function this GO :0006957 and complement activation, this GO :0005515 : protein binding, this GO :0005515 : protein binding, V-set and immunoglobulin domain containing 4
Identity: 17032
Gene: VSIG4 | More about : VSIG4
Long gene name: V-set and immunoglobulin domain containing 4
Synonyms: Z39IG
Locus: Xq12
Discovery year: 2004-09-10
GenBank acession: AJ132502
Entrez gene record: 11326
Pubmed identfication: 11004523 17016555 17016562
RefSeq identity: NM_007268
Classification: V-set domain containing Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000021727
Locus Specific Databases: Mental Retardation database

Related Products :

CP83 Recombinant Mouse VSIG4 (C-6His) 500 µg 1186 € novo mouse
C549 Recombinant Human V-Set and Ig Domain-Containing Protein 4, VSIG4, CRIg (C-6His) 10 µg 121 € novo human
RP-1599M Recombinant Mouse VSIG4 Protein (His & Fc Tag) 50μg 624 € adv mouse
RP-1598M Recombinant Mouse VSIG4 Protein (His Tag) 50μg 624 € adv mouse
CD69 Recombinant Human V-Set and Ig Domain-Containing Protein 4, VSIG4, CRIg (C-Fc) 50 µg 263 € novo human
RP-1639H Recombinant Human VSIG4 Protein (His Tag) 50μg 624 € adv human
GENTAUR-58be4352f388c Anti- VSIG4 Antibody 100ug 370 € MBS Polyclonals human
abx939568 Anti-VSIG4 siRNA inquire 50 € abbex human
GWB-49E761 VSIG4 antibody 1 x 1 vial 411 € genways human
GWB-MN888F VSIG4 antibody 1 vial 521 € genways human
bs-0479R VSIG4 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
LV356315 VSIG4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-CC1AD5 VSIG4 Over-expression Lysate reagent 1 vial 463 € genways human
MBS617290 VSIG4 (V-set and Ig Domain-containing Protein 4, Z39Ig) Antibody 100ug 774 € MBS Polyclonals_1 human
CM35 Recombinant Human, Mouse, Rat Irisin, FNDC5 (C-6His) 10 µg 156 € novo rat
CI98 Recombinant Mouse 5'-Nucleotidase, NT5E, CD73 (C-6His) 1 mg 2486 € novo mouse
CI89 Recombinant Mouse Adiponectin, Acrp30, AdipoQ (C-6His, Human Cells) 500 µg 1613 € novo human
CH26 Recombinant Mouse Adiponectin, Acrp30, AdipoQ ((N-6His, E. coli) 10 µg 146 € novo e-coli
C685 Recombinant Mouse Alpha-1-antitrypsin 1-1, Serpin A1a (C-6His) 1 mg 2486 € novo mouse
C695 Recombinant Mouse α-1-Antitrypsin 1-3, SERPIN A1b (C-6His) 10 µg 202 € novo human
CK23 Recombinant Mouse α-Synuclein, SNCA (N-6His) 1 mg 1674 € novo human
CJ05 Recombinant Mouse Apolipoprotein E, ApoE (C-6His) 10 µg 156 € novo mouse
CP55 Recombinant Mouse B7-1, CD80 (C-6His) 50 µg 141 € novo mouse
CP44 Recombinant Mouse B7-2, CD86 (C-6His) 10 µg 100 € novo mouse
CM83 Recombinant Mouse B7-H3, CD276(C-6His) 50 µg 232 € novo mouse
CP80 Recombinant Mouse Basigin, CD147 (C-6His) 50 µg 303 € novo mouse
C747 Recombinant Mouse Betacellulin, BTC (N-6His) 1 mg 2283 € novo mouse
CJ03 Recombinant Mouse BMP Receptor IA, ALK-3, CD292 (C-Fc-6His) 500 µg 709 € novo mouse
CB55 Recombinant Mouse Bone Sialoprotein 2, IBSP (C-6His) 10 µg 126 € novo mouse
CS10 Recombinant Mouse Butyrophilin Subfamily 1 Member A1, BTN1A1 (C-6His) 10 µg 146 € novo mouse