Recombinant Mouse RANK, TNFRSF11A (C-6His)

Contact us
Catalog number: CS23
Price: 602 €
Supplier: genways
Product name: Recombinant Mouse RANK, TNFRSF11A (C-6His)
Quantity: 1 vial
Other quantities: 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Receptor Activator of NF-kappa B is produced by our Mammalian expression system and the target gene encoding Val31-Ser214 is expressed with a 6His tag at the C-terminus
Molecular Weight: 21, 3 kD
UniProt number: O35305
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: TNFRSF11A (C-6His), RANK
Short name: TNFRSF11A (C-6His), Recombinant Mouse RANK
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: NFKB activator (C-6His), member 11a, tumor necrosis factor receptor superfamily, recombinant Mouse RANK
Alternative technique: rec
Alternative to gene target: CD265 and FEO and LOH18CR1 and ODFR and OFE and OPTB7 and OSTS and PDB2 and RANK and TRANCER, Cell surfaces, NFKB activator, TNFRSF11A and IDBG-4279 and ENSG00000141655 and 8792, TNFRSF11A and IDBG-644974 and ENSBTAG00000007569 and 530884, Tnfrsf11a and IDBG-185529 and ENSMUSG00000026321 and 21934, member 11a, metal ion binding, this GO :0001503 and ossification and biological process this GO :0002250 and adaptive immune response and biological process this GO :0002548 and monocyte chemotaxis and biological process this GO :0004872 and receptor activity and molecular function this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009314 and response to radiation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019955 and cytokine binding and molecular function this GO :0030316 and osteoclast differentiation and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0034097 and response to cytokine and biological process this GO :0034612 and response to tumor necrosis factor and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043507 and positive regulation of JUN kinase activity and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048535 and lymph node development and biological process this GO :0051091 and positive regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0060086 and circadian temperature homeostasis and biological process this GO :0060749 and mammary gland alveolus development and biological process this GO :0070555 and response to interleukin-1 and biological process this GO :0071812 and positive regulation of fever generation by positive regulation of prostaglandin secretion and biological process this GO :0071847 and TNFSF11-mediated signaling pathway and biological process this GO :0071848 and positive regulation of ERK1 and ERK2 cascade via TNFSF11-mediated signaling and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0019955 : cytokine binding and also this GO :0046872 : metal ion binding, this GO :0004888 : transmembrane signaling receptor activity, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005515 : protein binding, this GO :0019955 : cytokine binding, this GO :0046872 : metal ion binding, tumor necrosis factor receptor superfamily
Identity: 11908
Gene: TNFRSF11A | More about : TNFRSF11A
Long gene name: TNF receptor superfamily member 11a
Synonyms gene: PDB2 LOH18CR1
Synonyms gene name: 18, NFKB activator , activator of NFKB Paget disease of bone 2 loss of heterozygosity, chromosomal region 1 tumor necrosis factor receptor superfamily, member 11a, member 11a, tumor necrosis factor receptor superfamily
Synonyms: RANK CD265 FEO
Locus: 18q21, 33
Discovery year: 1998-12-04
GenBank acession: AF018253
Entrez gene record: 8792
Pubmed identfication: 9367155 10615125
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000132779
Locus Specific Databases: LRG_194

Related Products :

CS23 Recombinant Mouse RANK, TNFRSF11A (C-6His) 1 mg 2283 € novo mouse
CK64 Recombinant Human RANK, TNFRSF11A, CD265 (C-6His) 1 mg 1014 € novo human
GENTAUR-58bde5cae6f5e Mouse Monoclonal [clone 9A725] (IgG1) to Human TNFRSF11A / RANK Antibody 50ug 597 € MBS mono human
MBS241870 PAb (IgG) to Human TNFRSF11A / RANK 50ug 597 € MBS Polyclonals_1 human
CJ94 Recombinant Mouse TRANCE, RANK L, TNFSF11 (C-6His) 500 µg 1613 € novo mouse
CK63 Recombinant Human RANK L, TRANCE, TNFSF11 (N-6His) 1 mg 2486 € novo human
RP-2258R Recombinant Rat TNFRSF11A Protein (Fc Tag) 100μg 659 € adv rat
RP-2259R Recombinant Rat TNFRSF11A Protein (His Tag) 100μg 659 € adv rat
103-M479 Anti-Mouse TNFRSF11A 100ug 336 € Reliatech antibodies mouse
GENTAUR-58bd1be71abf1 Mouse Tumor necrosis factor receptor superfamily member 11A (Tnfrsf11a) 100ug 1586 € MBS Recombinant Proteins mouse
GENTAUR-58bd1be754640 Mouse Tumor necrosis factor receptor superfamily member 11A (Tnfrsf11a) 1000ug 1586 € MBS Recombinant Proteins mouse
GENTAUR-58bd1be7a10fb Mouse Tumor necrosis factor receptor superfamily member 11A (Tnfrsf11a) 100ug 2089 € MBS Recombinant Proteins mouse
GENTAUR-58bd1be7e7b2d Mouse Tumor necrosis factor receptor superfamily member 11A (Tnfrsf11a) 1000ug 2089 € MBS Recombinant Proteins mouse
GWB-E10BB8 Tumor Necrosis Factor Receptor Superfamily Member 11a Activator Of NFKB (TNFRSF11A) Mouse antibody to or anti-Human Monoclonal (aa326-616) (9 1 vial 602 € genways human
GENTAUR-58be01c2c7611 Anti- TNFRSF11A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be01c32a1b3 Anti- TNFRSF11A Antibody 0.12 ml 348 € MBS Polyclonals human
abx937587 Anti-TNFRSF11A siRNA inquire 50 € abbex human
abx937588 Anti-TNFRSF11A siRNA 30 nmol 717 € abbex human
MBS551251 Rat TNFRSF11A Affinity Purified Polyclonal Antibody 1000ug 2420 € MBS Polyclonals_1 rat
GWB-E21270 TNFRSF11A Over-expression Lysate reagent 1 vial 873 € genways human
GWB-6581CA Tumor Necrosis Factor Receptor Superfamily Member 11a Activator Of NFKB (TNFRSF11A) Rabbit antibody to or anti-Human Polyclonal (aa603-613) A 1 tube 602 € genways human
OBT4517 Mouse RANK (Receptor Activator of NF Kappa-B), Clone: LOB14-8, Rat Mouse Monoclonal antibody-Mouse; flow/ELISA/IP 0.25 mg Ask price € accurate-monoclonals mouse
CR06 Recombinant Mouse TRANCE, RANK L, TNFSF11 1 mg 2486 € novo mouse
YSRTMCA2085 RANK (Receptor Activator of NF Kappa-B), Clone: LOB14-8, Rat Mouse Monoclonal antibody-Mouse; flow/ELISA/IP 0.25 mg 391 € accurate-monoclonals mouse
abx263182 Anti-Soluble RANK Ligand, GST Tag Protein (Recombinant) 10 µg 340 € abbex human
abx260745 Anti-Soluble RANK Ligand, His Tag Protein (Recombinant) 5 µg 238 € abbex human
abx262236 Anti-Soluble RANK Ligand Protein (Recombinant) 2 µg 238 € abbex human
abx262238 Anti-Soluble RANK Ligand Protein (Recombinant) 10 µg 340 € abbex human
abx263125 Anti-Soluble RANK Receptor Protein (Recombinant) 1 mg 1398 € abbex human
GWB-B354EC RANK Ligand Soluble (RANKL) recombinant Human 1 vial 602 € genways human