| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Receptor Activator of NF-kappa B is produced by our Mammalian expression system and the target gene encoding Val31-Ser214 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
21, 3 kD |
| UniProt number: |
O35305 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
TNFRSF11A (C-6His), RANK |
| Short name: |
TNFRSF11A (C-6His), Recombinant Mouse RANK |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
NFKB activator (C-6His), member 11a, tumor necrosis factor receptor superfamily, recombinant Mouse RANK |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD265 and FEO and LOH18CR1 and ODFR and OFE and OPTB7 and OSTS and PDB2 and RANK and TRANCER, Cell surfaces, NFKB activator, TNFRSF11A and IDBG-4279 and ENSG00000141655 and 8792, TNFRSF11A and IDBG-644974 and ENSBTAG00000007569 and 530884, Tnfrsf11a and IDBG-185529 and ENSMUSG00000026321 and 21934, member 11a, metal ion binding, this GO :0001503 and ossification and biological process this GO :0002250 and adaptive immune response and biological process this GO :0002548 and monocyte chemotaxis and biological process this GO :0004872 and receptor activity and molecular function this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009314 and response to radiation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019955 and cytokine binding and molecular function this GO :0030316 and osteoclast differentiation and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0034097 and response to cytokine and biological process this GO :0034612 and response to tumor necrosis factor and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043507 and positive regulation of JUN kinase activity and biological process this GO :0046872 and metal ion binding and molecular function this GO :0048535 and lymph node development and biological process this GO :0051091 and positive regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0060086 and circadian temperature homeostasis and biological process this GO :0060749 and mammary gland alveolus development and biological process this GO :0070555 and response to interleukin-1 and biological process this GO :0071812 and positive regulation of fever generation by positive regulation of prostaglandin secretion and biological process this GO :0071847 and TNFSF11-mediated signaling pathway and biological process this GO :0071848 and positive regulation of ERK1 and ERK2 cascade via TNFSF11-mediated signaling and biological process, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0019955 : cytokine binding and also this GO :0046872 : metal ion binding, this GO :0004888 : transmembrane signaling receptor activity, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005515 : protein binding, this GO :0019955 : cytokine binding, this GO :0046872 : metal ion binding, tumor necrosis factor receptor superfamily |
| Identity: |
11908 |
| Gene: |
TNFRSF11A |
More about : TNFRSF11A |
| Long gene name: |
TNF receptor superfamily member 11a |
| Synonyms gene: |
PDB2 LOH18CR1 |
| Synonyms gene name: |
18, NFKB activator , activator of NFKB Paget disease of bone 2 loss of heterozygosity, chromosomal region 1 tumor necrosis factor receptor superfamily, member 11a, member 11a, tumor necrosis factor receptor superfamily |
| Synonyms: |
RANK CD265 FEO |
| Locus: |
18q21, 33 |
| Discovery year: |
1998-12-04 |
| GenBank acession: |
AF018253 |
| Entrez gene record: |
8792 |
| Pubmed identfication: |
9367155 10615125 |
| Classification: |
CD molecules Tumor necrosis factor receptor superfamily |
| Havana BLAST/BLAT: |
OTTHUMG00000132779 |
| Locus Specific Databases: |
LRG_194 |