| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Receptor Activator of NF-kappa-B ligand is produced by our E, coli expression system and the target gene encoding Ile140-Asp317 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
22, 4 kD |
| UniProt number: |
O14788 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
TNFSF11 (N-6His), TRANCE, RANK L |
| Short name: |
TNFSF11 (N-6His), TRANCE, Recombinant RANK L |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
TRANCE, member 11 (N-6His), sapiens RANK L, tumor necrosis factor (ligand) superfamily, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD254 and hRANKL2 and ODF and OPGL and OPTB2 and RANKL and sOdf and TRANCE, Extracellular, TNFSF11 and IDBG-28393 and ENSG00000120659 and 8600, TNFSF11 and IDBG-628731 and ENSBTAG00000008924 and 513836, Tnfsf11 and IDBG-182101 and ENSMUSG00000022015 and 21943, member 11, this GO :0001503 and ossification and biological process this GO :0002158 and osteoclast proliferation and biological process this GO :0002548 and monocyte chemotaxis and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007257 and activation of JUN kinase activity and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0016020 and membrane and cellular component this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030316 and osteoclast differentiation and biological process this GO :0032813 and tumor necrosis factor receptor superfamily binding and molecular function this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0033598 and mammary gland epithelial cell proliferation and biological process this GO :0034112 and positive regulation of homotypic cell-cell adhesion and biological process this GO :0042327 and positive regulation of phosphorylation and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0045087 and innate immune response and biological process this GO :0045453 and bone resorption and biological process this GO :0045670 and regulation of osteoclast differentiation and biological process this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0045780 and positive regulation of bone resorption and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0050870 and positive regulation of T cell activation and biological process this GO :0051091 and positive regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051260 and protein homooli this GO merization and biological process this GO :0051466 and positive regulation of corticotropin-releasing hormone secretion and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0055074 and calcium ion homeostasis and biological process this GO :0060749 and mammary gland alveolus development and biological process this GO :0070371 and ERK1 and ERK2 cascade and biological process this GO :0071812 and positive regulation of fever generation by positive regulation of prostaglandin secretion and biological process this GO :0071847 and TNFSF11-mediated signaling pathway and biological process this GO :0071848 and positive regulation of ERK1 and ERK2 cascade via TNFSF11-mediated signaling and biological process this GO :1902533 and positive regulation of intracellular signal transduction and biological process this GO :2001206 and positive regulation of osteoclast development and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0032813 : tumor necrosis factor receptor superfamily binding, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0032813 : tumor necrosis factor receptor superfamily binding, tumor necrosis factor receptor superfamily binding, tumor necrosis factor (ligand) superfamily |
| Identity: |
11926 |
| Gene: |
TNFSF11 |
More about : TNFSF11 |
| Long gene name: |
tumor necrosis factor superfamily member 11 |
| Synonyms gene name: |
member 11 , tumor necrosis factor (ligand) superfamily |
| Synonyms: |
TRANCE RANKL OPGL ODF CD254 |
| Locus: |
13q14 |
| Discovery year: |
1998-12-04 |
| GenBank acession: |
AF013171 |
| Pubmed identfication: |
9312132 9367155 |
| Classification: |
Tumor necrosis factor superfamily CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000016807 |