| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro158 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
42, 8 kD |
| UniProt number: |
Q61735-2 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD47 (C-Fc), OA3, IAP |
| Short name: |
CD47 (C-Fc), OA3, Recombinant Mouse IAP |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD47 molecule (C-fragment c), OA3, recombinant Mouse IAP |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD47 and IDBG-48744 and ENSG00000196776 and 961, CD47 and IDBG-631689 and ENSBTAG00000003585 and 282661, Cd47 and IDBG-165137 and ENSMUSG00000055447 and 16423, IAP and MER6 and OA3, Plasma membranes, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007229 and integrin-mediated signaling pathway and biological process this GO :0007596 and blood coagulation and biological process this GO :0008228 and opsonization and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009617 and response to bacterium and biological process this GO :0022409 and positive regulation of cell-cell adhesion and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0050870 and positive regulation of T cell activation and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070053 and thrombospondin receptor activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0070053 : thrombospondin receptor activity, this GO :0070053 : thrombospondin receptor activity, thrombospondin receptor activity, CD47 molecule |
| Identity: |
1682 |
| Gene: |
CD47 |
More about : CD47 |
| Long gene name: |
CD47 molecule |
| Synonyms gene: |
MER6 |
| Synonyms gene name: |
CD47 antigen (Rh-related antigen, integrin-associated signal transducer) |
| Synonyms: |
IAP OA3 |
| Synonyms name: |
antigen identified by monoclonal antibody 1D8 antigenic surface determinant protein OA3 integrin associated protein Rh-related antigen leukocyte surface antigen CD47 CD47 glycoprotein |
| Locus: |
3q13, 12 |
| Discovery year: |
1994-12-12 |
| Entrez gene record: |
961 |
| Pubmed identfication: |
8294396 2277087 |
| RefSeq identity: |
NM_001777 |
| Classification: |
Immunoglobulin like domain containing CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000044216 |