| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro139 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
14, 76 kD |
| UniProt number: |
Q08722 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 8, 2 um filtered solution of 10 mM Tris-Citrate, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
IAP, OA3 (C-6His), CD47 |
| Short name: |
IAP, OA3 (C-6His), Recombinant CD47 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
IAP, OA3 (C-6His), sapiens CD47 molecule, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD47 and IDBG-48744 and ENSG00000196776 and 961, CD47 and IDBG-631689 and ENSBTAG00000003585 and 282661, Cd47 and IDBG-165137 and ENSMUSG00000055447 and 16423, IAP and MER6 and OA3, Plasma membranes, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007229 and integrin-mediated signaling pathway and biological process this GO :0007596 and blood coagulation and biological process this GO :0008228 and opsonization and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009617 and response to bacterium and biological process this GO :0022409 and positive regulation of cell-cell adhesion and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0050870 and positive regulation of T cell activation and biological process this GO :0050900 and leukocyte migration and biological process this GO :0070053 and thrombospondin receptor activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0070053 : thrombospondin receptor activity, this GO :0070053 : thrombospondin receptor activity, thrombospondin receptor activity, CD47 molecule |
| Identity: |
1682 |
| Gene: |
CD47 |
More about : CD47 |
| Long gene name: |
CD47 molecule |
| Synonyms gene: |
MER6 |
| Synonyms gene name: |
CD47 antigen (Rh-related antigen, integrin-associated signal transducer) |
| Synonyms: |
IAP OA3 |
| Synonyms name: |
antigen identified by monoclonal antibody 1D8 antigenic surface determinant protein OA3 integrin associated protein Rh-related antigen leukocyte surface antigen CD47 CD47 glycoprotein |
| Locus: |
3q13, 12 |
| Discovery year: |
1994-12-12 |
| Entrez gene record: |
961 |
| Pubmed identfication: |
8294396 2277087 |
| RefSeq identity: |
NM_001777 |
| Classification: |
Immunoglobulin like domain containing CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000044216 |