Recombinant Mouse C-X-C Motif Chemokine 16, CXCL16, SR-PSOX (C-6His)

Contact us
Catalog number: CC44
Price: 202 €
Supplier: novo
Product name: Recombinant Mouse C-X-C Motif Chemokine 16, CXCL16, SR-PSOX (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 1 kD, 20
UniProt number: Q8BSU2
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4 , Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAWVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CXCL16, SR-PSOX (C-6His), C-X-C Motif Chemokine 16
Short name: CXCL16, SR-PSOX (C-6His), Recombinant Mouse C-X-C Motif Chemokine 16
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: SR-PSOX (C-6His), chemokine (C-X-C motif) ligand 16, recombinant Mouse C-X-C Motif Chemokine 16
Alternative technique: rec
Alternative to gene target: CXCL16 and IDBG-19403 and ENSG00000161921 and 58191, CXCL16 and IDBG-634352 and ENSBTAG00000031998 and 511671, Cxcl16 and IDBG-194380 and ENSMUSG00000018920 and 66102, Extracellular, chemokine activity, this GO :0005041 and low-density lipoprotein receptor activity and molecular function this GO :0005044 and scavenger receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0006935 and chemotaxis and biological process this GO :0008009 and chemokine activity and molecular function this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030307 and positive regulation of cell growth and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0034097 and response to cytokine and biological process this GO :0034341 and response to interferon-gamma and biological process this GO :0034612 and response to tumor necrosis factor and biological process this GO :0048247 and lymphocyte chemotaxis and biological process, this GO :0005041 : low-density lipoprotein receptor activity, this GO :0005041 : low-density lipoprotein receptor activity and also this GO :0005044 : scavenger receptor activity and also this GO :0005102 : receptor binding and also this GO :0008009 : chemokine activity, this GO :0005044 : scavenger receptor activity, this GO :0005102 : receptor binding, this GO :0008009 : chemokine activity, chemokine (C-X-C motif) ligand 16
Identity: 16642
Gene: CXCL16 | More about : CXCL16
Long gene name: C-X-C motif chemokine ligand 16
Synonyms gene name: chemokine (C-X-C motif) ligand 16
Synonyms: SR-PSOX CXCLG16 SRPSOX
Synonyms name: CXC chemokine ligand 16
Locus: 17p13, 2
Discovery year: 2001-09-21
GenBank acession: AF275260
Entrez gene record: 58191
Pubmed identfication: 11017100 11060282
RefSeq identity: NM_022059
Classification: Endogenous ligands Chemokine ligands Scavenger receptors
Havana BLAST/BLAT: OTTHUMG00000090761

Related Products :

CC44 Recombinant Mouse C-X-C Motif Chemokine 16, CXCL16, SR-PSOX (C-6His) 1 mg 2283 € novo mouse
RP-1228M Recombinant Mouse CXCL16 / SR-PSOX Protein (His Tag) 20μg 456 € adv mouse
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58bdd53f5fd8c Anti- Chemokine C-X-C-Motif Ligand 16 (CXCL16) Antibody 100ug 359 € MBS Polyclonals human
GENTAUR-58bdd53fac8c7 Anti- Chemokine C-X-C-Motif Ligand 16 (CXCL16) Antibody 50ug 293 € MBS Polyclonals human
GENTAUR-58bdd7f36335d Anti- Chemokine C-X-C-Motif Ligand 16 (CXCL16) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdda7616d77 Anti- Chemokine C-X-C-Motif Ligand 16 (CXCL16) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddb54b610b Anti- Chemokine C-X-C-Motif Ligand 16 (CXCL16) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bddc25726e0 Anti- Chemokine C-X-C-Motif Ligand 16 (CXCL16) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bddc25d872d Anti- Chemokine C-X-C-Motif Ligand 16 (CXCL16) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bddc337fc0a Anti- Chemokine C-X-C-Motif Ligand 16 (CXCL16) Antibody 100ug 520 € MBS Polyclonals human
EKU03114 Chemokine C-X-C-Motif Ligand 16 (CXCL16) ELISA kit 1 plate of 96 wells 542 € Biomatik ELISA kits human
EKU03115 Chemokine C-X-C-Motif Ligand 16 (CXCL16) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
AE48293PI-48 ELISA test for Pig C-X-C motif chemokine 16 (CXCL16) 1x plate of 48 wells 402 € abebio pig
DL-CXCL16-Hu Human Chemokine C-X-C-Motif Ligand 16 CXCL16 ELISA Kit 96T 672 € DL elisas human
AE48293PI-96 Pig C-X-C motif chemokine 16 (CXCL16) ELISA Kit 1x plate of 96 wells 671 € abebio pig
DL-CXCL16-Ra Rat Chemokine C-X-C-Motif Ligand 16 CXCL16 ELISA Kit 96T 904 € DL elisas rat
CS16 Recombinant Mouse C-C motif chemokine 2, CCL2 (C-6His) 1 mg 2486 € novo mouse
CR13 Recombinant Mouse C-C Motif Chemokine 3, CCL3, MIP-1a(N-6His) 1 mg 2486 € novo mouse
CS45 Recombinant Mouse C-C motif Chemokine 8, CCL8, MCP-2 (C-6His) 10 µg 202 € novo mouse