Recombinant Mouse C-X-C Motif Chemokine 1, CXCL1, GRO α (C-6His)

Contact us
Catalog number: C786
Price: 355 €
Supplier: acr
Product name: Recombinant Mouse C-X-C Motif Chemokine 1, CXCL1, GRO α (C-6His)
Quantity: 25 Вµg
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines
Molecular Weight: 4 kD, 9
UniProt number: P12850
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPKVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: (C-6His), CXCL1, GRO &alpha, C-X-C Motif Chemokine 1
Short name: (C-6His), CXCL1, GRO &alpha, Recombinant Mouse C-X-C Motif Chemokine 1
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses
Alternative name: (C-6His), GRO &alpha, a), chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, recombinant Mouse C-X-C Motif Chemokine 1
Alternative technique: rec
Alternative to gene target: CXCL1 and IDBG-24070 and ENSG00000163739 and 2919, Extracellular, FSP and GRO1 and GROa and MGSA and MGSA-a and NAP-3 and SCYB1, alpha), growth factor activity, this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008047 and enzyme activator activity and molecular function this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0030036 and actin cytoskeleton organization and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008009 : chemokine activity and also this GO :0008047 : enzyme activator activity and also this GO :0008083 : growth factor activity, this GO :0008009 : chemokine activity, this GO :0008047 : enzyme activator activity, this GO :0008083 : growth factor activity, chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity
Identity: 4602
Gene: CXCL1 | More about : CXCL1
Long gene name: C-X-C motif chemokine ligand 1
Synonyms gene: MGSA GRO1 FSP
Synonyms gene name: GRO1 oncogene (melanoma growth stimulating activity, alpha) , alpha) fibroblast secretory protein chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity
Synonyms: SCYB1 GROa MGSA-a NAP-3
Synonyms name: alpha , melanoma growth stimulating activity
Locus: 4q13, 3
Discovery year: 1988-08-11
GenBank acession: J03561
Entrez gene record: 2919
Pubmed identfication: 2217207
Classification: Endogenous ligands Chemokine ligands
Havana BLAST/BLAT: OTTHUMG00000160866

Related Products :

C786 Recombinant Mouse C-X-C Motif Chemokine 1, CXCL1, GRO α (C-6His) 1 mg 2283 € novo human
MBS621737 CCL14, aa1-16 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621594 CCL14, aa21-35 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621551 CCL14, aa44-55 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
MBS621623 CCL14, aa62-74 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 20ul 509 € MBS Polyclonals_1 human
MBS622517 CCL14, aa8-15 (Chemokine (C-C motif) ligand 14, CC-1, CC-3, C-C motif chemokine 14, Chemokine CC-1/CC-3, CKb1, FLJ16015, HCC-1, HCC-1/HCC-3, HCC-1(1-74), HCC-3, MCIF, NCC2, NCC-2, SCYA14, SCYL2, Small-inducible cytokine A14, SY14) Antibody 100ul 1089 € MBS Polyclonals_1 human
C597 Recombinant Human C-X-C Motif Chemokine 1, CXCL1 (C-6His) 1 mg 1836 € novo human
MBS624336 CX3CR1, EL (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624136 CX3CR1, NT (Beta Chemokine Receptor-like 1, CCRL1, Chemokine C-X3-C Motif Receptor 1, CX3C Chemokine Receptor 1, C-X3-C CKR-1, CX3C CKR-1, CMK-BRL-1, CMKBLR1, CMKDR1, Fractalkine Receptor, GPR13, GPRV28, V28) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS624063 Macrophage, Monocyte Chemotactic Protein-1 (CCL2, Chemokine (C-C motif) ligand 2, C-C motif chemokine 2, GDCF-2, HC11, HSMCR30, MCAF, MCP1, MCP-1, MGC9434, Monocyte chemoattractant protein 1, Monocyte chemotactic and activating factor, Monocyte chemotacti Antibody 100ug 763 € MBS Polyclonals_1 human
MBS622737 TRIM14 (Tripartite Motif Containing 14, Tripartite Motif-containing 14, Tripartite Motif Protein 14, Tripartite Motif Protein TRIM14, TRIM 14, 5830400N10Rik, KIAA0129) 100ug 696 € MBS Polyclonals_1 human
MBS619508 TRIM4 (Tripartite Motif Containing 4, Tripartite Motif-containing 4, Tripartite Motif Protein 4, Tripartite Motif Protein TRIM4, Ring Finger Protein 87, RNF87) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS620811 TRIM5 (Tripartite Motif Containing 5, Tripartite Motif-containing 5, Tripartite Motif Protein 5, Tripartite Motif Protein TRIM5, RING Finger Protein 88, RNF88) Antibody 100ug 735 € MBS Polyclonals_1 human
abx260406 Anti-GRO alpha (CXCL1), His Tag Protein (Recombinant) 1 mg 2428 € abbex human
abx261582 Anti-GRO alpha (CXCL1) Protein (Recombinant) 5 µg 238 € abbex human
abx261606 Anti-GRO alpha (CXCL1) Protein (Recombinant) 1 mg 3559 € abbex human
GWB-P0224C CXCL1/GRO alpha, 35-107aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-3646DB KC/CXCL1 (gro-alpha) (recombinant) Murine 1 x 1 vial 579 € genways human
RP-1031 Recombinant (E.Coli) Human GRO-alpha (CXCL1) 5 μg 188 € adi human
GWB-45AB5F Recombinant Human GRO-alpha (CXCL1) His Tag bulk Ask price € genways bulk human
MBS620038 Macrophage inflammatory protein 2-alpha (CXCL2, Chemokine (C-X-C motif) ligand 2, CINC-2a, GRO2, GROb, GROB, Gro-beta, Growth-regulated protein beta, Macrophage inflammatory protein 2-alpha precursor, MGSA-b, MGSA beta, MIP2, MIP2A, MIP-2a, MIP2-alpha, SC Antibody 100ug 591 € MBS Polyclonals_1 human
RP-1037 Recombinant Mouse (E.Coli) GRO/KC (CXCL1) 5 μg 188 € adi mouse
abx261870 Anti-GRO/KC (CXCL1), His Tag Protein (Recombinant) 1 mg 4675 € abbex human
abx260684 Anti-GRO/KC (CXCL1) Protein (Recombinant) 20 µg 340 € abbex human
GWB-BIG09F Recombinant Human GRO/MGSA (CXCL1) bulk Ask price € genways bulk human
GWB-BIG1C3 Recombinant Rat GRO/KC (CXCL1) bulk Ask price € genways bulk rat
AR50349PU-N anti-CXCL1 / GRO-alpha (25-96, His-tag) Antibody 0,5 mg 1413 € acr human
AR50349PU-S anti-CXCL1 / GRO-alpha (25-96, His-tag) Antibody 0,1 mg 587 € acr human
PRO-50006-0010 anti-CXCL1 / GRO-alpha (35-107) Antibody 10 Вµg 268 € acr human
PRO-50006-0025 anti-CXCL1 / GRO-alpha (35-107) Antibody 25 Вµg 355 € acr human