| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1, Chemokines |
| Molecular Weight: |
4 kD, 9 |
| UniProt number: |
P12850 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPKVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
(C-6His), CXCL1, GRO &alpha, C-X-C Motif Chemokine 1 |
| Short name: |
(C-6His), CXCL1, GRO &alpha, Recombinant Mouse C-X-C Motif Chemokine 1 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses |
| Alternative name: |
(C-6His), GRO &alpha, a), chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, recombinant Mouse C-X-C Motif Chemokine 1 |
| Alternative technique: |
rec |
| Alternative to gene target: |
CXCL1 and IDBG-24070 and ENSG00000163739 and 2919, Extracellular, FSP and GRO1 and GROa and MGSA and MGSA-a and NAP-3 and SCYB1, alpha), growth factor activity, this GO :0005102 and receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006935 and chemotaxis and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0008009 and chemokine activity and molecular function this GO :0008047 and enzyme activator activity and molecular function this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0030036 and actin cytoskeleton organization and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0043085 and positive regulation of catalytic activity and biological process this GO :0060326 and cell chemotaxis and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0008009 : chemokine activity and also this GO :0008047 : enzyme activator activity and also this GO :0008083 : growth factor activity, this GO :0008009 : chemokine activity, this GO :0008047 : enzyme activator activity, this GO :0008083 : growth factor activity, chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity |
| Identity: |
4602 |
| Gene: |
CXCL1 |
More about : CXCL1 |
| Long gene name: |
C-X-C motif chemokine ligand 1 |
| Synonyms gene: |
MGSA GRO1 FSP |
| Synonyms gene name: |
GRO1 oncogene (melanoma growth stimulating activity, alpha) , alpha) fibroblast secretory protein chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity |
| Synonyms: |
SCYB1 GROa MGSA-a NAP-3 |
| Synonyms name: |
alpha , melanoma growth stimulating activity |
| Locus: |
4q13, 3 |
| Discovery year: |
1988-08-11 |
| GenBank acession: |
J03561 |
| Entrez gene record: |
2919 |
| Pubmed identfication: |
2217207 |
| Classification: |
Endogenous ligands Chemokine ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000160866 |