Recombinant Mouse Serine Protease Inhibitor A3N, Serpin A3N (C-6His)

Contact us
Catalog number: C665
Price: 496 €
Supplier: novo
Product name: Recombinant Mouse Serine Protease Inhibitor A3N, Serpin A3N (C-6His)
Quantity: 50 µg
Other quantities: 1 mg 2486€ 500 µg 1674€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Not all receptor antagonist that bind to enzymes are inhibitors, Since blocking an enzyme's activity can kill a pathogen , activator, caspase, esterase inhibitors , lipoprotein, many drugs are enzyme inhibitors, papain, pathway, peptidase, protease , proteinase, trypsin, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme,  , Tissue, acrosin, activity, and decreases its , are , bind to enzymes and increase their , enzymatic activity, enzyme activator ligands or agonists , enzyme receptor , imbalance, metabolic , or correct a , or receptor ligands or receptor antagonists that bind to an , proteins 
Molecular Weight: 45, 6 kD
UniProt number: Q91WP6
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: Serpin A3N (C-6His), Serine Protease Inhibitor A3N
Short name: Serpin A3N (C-6His), Recombinant Mouse Serine Protease Inhibitor A3N
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Serpin A3N (C-6His), recombinant Mouse Serine Protease suppressor A3N
Alternative technique: rec

Related Products :

C665 Recombinant Mouse Serine Protease Inhibitor A3N, Serpin A3N (C-6His) 1 mg 2486 € novo mouse
MBS622823 SERPINA10 (Serpin Peptidase Inhibitor Clade A (alpha-1 Antiproteinase Antitrypsin) Member 10, Serpin A10, Protein Z-dependent Protease Inhibitor, Protein Z-dependent Protease Inhibitor Precursor, PZ-dependent Protease Inhibitor, PZI, ZPI) 100ug 735 € MBS Polyclonals_1 human
MBS621879 SERPINB9 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 9, Serpin B9, Cytoplasmic Antiproteinase 3, CAP3, CAP-3, Protease Inhibitor 9, PI9, PI-9) 100ug 735 € MBS Polyclonals_1 human
abx254855 Anti-Mouse Serine protease inhibitor A3N ELISA Kit inquire 50 € abbex mouse
GENTAUR-58bd26d66bd30 Rat Serine protease inhibitor A3N (Serpina3n) 100ug 2100 € MBS Recombinant Proteins rat
GENTAUR-58bd26d6a7c3f Rat Serine protease inhibitor A3N (Serpina3n) 1000ug 2100 € MBS Recombinant Proteins rat
GENTAUR-58bd26d70324a Rat Serine protease inhibitor A3N (Serpina3n) 100ug 2614 € MBS Recombinant Proteins rat
GENTAUR-58bd26d74ac4f Rat Serine protease inhibitor A3N (Serpina3n) 1000ug 2614 € MBS Recombinant Proteins rat
MBS619680 SERPINB6 (Serpin Peptidase Inhibitor Clade B (Ovalbumin) Member 6, Serpin B6, Cytoplasmic Antiproteinase, CAP, MGC111370, MSTP057, Placental Thrombin Inhibitor, PTI, Protease Inhibitor 6, Protease Inhibitor 6 (Placental Thrombin Inhibitor), PI6, PI-6) Antibody 100ug 735 € MBS Polyclonals_1 human
CD21 Recombinant Mouse Plasminogen Activator Inhibitor 1, PAI-1, SERPIN E1 (C-6His) 1 mg 2486 € novo mouse
CJ07 Recombinant Mouse Serpin G1, C1 Inhibitor (C-6His) 500 µg 1613 € novo mouse
CJ01 Recombinant Human Leukocyte Elastase Inhibitor, Serpin B1, SERPINB1 (C-6His) 1 mg 2283 € novo human
C535 Recombinant Human Serpin A5, Protein C Inhibitor (C-6His) 500 µg 1613 € novo human
CE54 Recombinant Human Serpin B6, Placental Thrombin Inhibitor (N-Trx, 6His) 50 µg 496 € novo human
C539 Recombinant Human Serpin G1, C1 Inhibitor (C-6His) 50 µg 369 € novo human
C685 Recombinant Mouse Alpha-1-antitrypsin 1-1, Serpin A1a (C-6His) 1 mg 2486 € novo mouse
C695 Recombinant Mouse α-1-Antitrypsin 1-3, SERPIN A1b (C-6His) 10 µg 202 € novo human
CK98 Recombinant Mouse Serpin D1, Heparin Cofactor II, HCF2 (C-6His) 50 µg 496 € novo mouse
CM08 Recombinant Mouse Serpin F2, Alpha-2-Antiplasmin (C-6His) 500 µg 1755 € novo mouse
MBS620645 Secretory Leukocyte Protease Inhibitor (SLPI, ALP, Antileukoproteinase, BLPI, HUSI, HUSI-1, HUSI-I, MPI, Mucus Proteinase Inhibitor, Protease Inhibitor WAP4, Secretory Leukocyte Peptidase Inhibitor, Seminal Proteinase Inhibitor, WAP4, WAP Four-Disulfide C Antibody 50ug 818 € MBS Polyclonals_1 human
CB56 Recombinant Human Angiotensinogen, Serpin A8, AGT (C-6His) 50 µg 496 € novo human
C533 Recombinant Human Serpin A1, alpha-1-Antitrypsin (C-6His) 500 µg 1613 € novo human
CA54 Recombinant Human Serpin A10, ZPI (C-6His) 500 µg 1613 € novo human
C534 Recombinant Human Serpin A3, alpha-1-Antichymotrypsin (C-6His) 1 mg 2283 € novo human
C928 Recombinant Human Serpin A4, Kallistatin (C-6His) 1 mg 2283 € novo human
C639 Recombinant Human Serpin A6 , Transcortin (C-6His) 50 µg 496 € novo human
C536 Recombinant Human Serpin A7, TBG (C-6His) 50 µg 369 € novo human
CI96 Recombinant Human Serpin B12, SERPINB12 (C-6His) 500 µg 1613 € novo human
CJ63 Recombinant Human Serpin B3, SERPINB3, SCCA1 (C-6His) 1 mg 2486 € novo human
CM24 Recombinant Human Serpin B3, SERPINB3, SCCA1 (N-6His) 50 µg 496 € novo human