Recombinant Human CD226 Antigen, DNAM-1, CD226 (C-6His)

Contact us
Catalog number: CS89
Price: 146 €
Supplier: novo
Product name: Recombinant Human CD226 Antigen, DNAM-1, CD226 (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 1318€ 50 µg 278€ 500 µg 963€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CD226 Antigen is produced by our Mammalian expression system and the target gene encoding Glu19-Asn247 is expressed with a 6His tag at the C-terminus
Molecular Weight: 26, 8 kD
UniProt number: Q15762
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD226 (C-6His), CD226 DNAM-1
Short name: CD226 (C-6His), DNAM-1, Recombinant CD226 Antigen
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD226 molecule (C-6His), DNAM-1, sapiens CD226 molecule protein, recombinant H
Alternative technique: rec
Alternative to gene target: CD226 and IDBG-4779 and ENSG00000150637 and 10666, CD226 and IDBG-643547 and ENSBTAG00000009266 and 615496, Cd226 and IDBG-163478 and ENSMUSG00000034028 and 225825, Cell surfaces, DNAM-1 and DNAM1 and PTA1 and TLiSA1, cell adhesion molecule binding, this GO :0001816 and cytokine production and biological process this GO :0002860 and positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target and biological process this GO :0002891 and positive regulation of immunoglobulin mediated immune response and biological process this GO :0005178 and integrin binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0008037 and cell recognition and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0019901 and protein kinase binding and molecular function this GO :0033005 and positive regulation of mast cell activation and biological process this GO :0045121 and membrane raft and cellular component this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0060369 and positive regulation of Fc receptor mediated stimulatory signaling pathway and biological process, this GO :0005178 : integrin binding, this GO :0005178 : integrin binding and also this GO :0005515 : protein binding and also this GO :0019901 : protein kinase binding and also this GO :0050839 : cell adhesion molecule binding, this GO :0005515 : protein binding, this GO :0019901 : protein kinase binding, this GO :0050839 : cell adhesion molecule binding, CD226 molecule
Identity: 16961
Gene: CD226 | More about : CD226
Long gene name: CD226 molecule
Synonyms gene name: CD226 antigen
Synonyms: DNAM-1 DNAM1 PTA1 TLiSA1
Locus: 18q22, 2
Discovery year: 2003-10-02
GenBank acession: U56102
Entrez gene record: 10666
Pubmed identfication: 8673704
RefSeq identity: NM_006566
Classification: CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000132809

Related Products :

CS89 Recombinant Human CD226 Antigen, DNAM-1, CD226 (C-6His) 500 µg 963 € novo human
CS90 Recombinant Human CD226 Antigen, DNAM-1, CD226 (C-Fc) 1 mg 1318 € novo human
CS07 Recombinant Mouse DNAX Accessory Molecule-1, DNAM-1, CD226 (C-6His) 500 µg 1613 € novo mouse
RP-0295H Recombinant Human CD226 / DNAM-1 Protein (His & Fc Tag) 50μg 624 € adv human
RP-0294H Recombinant Human CD226 / DNAM-1 Protein (His Tag) 50μg 624 € adv human
RP-1112M Recombinant Mouse CD226 / DNAM-1 Protein (His & Fc Tag) 50μg 624 € adv mouse
RP-1111M Recombinant Mouse CD226 / DNAM-1 Protein (His Tag) 50μg 624 € adv mouse
RP-2043R Recombinant Rat CD226 / DNAM-1 Protein (Fc Tag) 50μg 624 € adv rat
GWB-ASC393 Human CD226/DNAM-1 (Ab-329) Antibody bulk Ask price € genways bulk human
GWB-ASB373 Human CD226/DNAM-1 (Phospho-Ser329) Antibody bulk Ask price € genways bulk human
A02C0148 anti-CD226/DNAM-1 (Ab-329) Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58be47a2d2c10 Anti- CD226/DNAM-1 Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58bcd9aa59e1d Macaca mulatta (Rhesus macaque) CD226 antigen (CD226) 1000ug 1663 € MBS Recombinant Proteins rhesus
GENTAUR-58bcd9aaa21d1 Macaca mulatta (Rhesus macaque) CD226 antigen (CD226) 1000ug 2166 € MBS Recombinant Proteins rhesus
101-M382 Anti-Human DNAM-1 100ug 336 € Reliatech antibodies human
MBS620009 CD1c (Cluster of differentiation antigen 1c, CD1c antigen, CD1c antigen c polypeptide, CD1c molecule, Cortical thymocyte antigen CD1c, Differentiation antigen CD1 alpha 3, R7, T cell surface glycoprotein CD1c) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS620858 Dystonin (230kD bullous pemphigoid antigen, BP240, BPA, BPAG1, Bullous pemphigoid antigen, Bullous pemphigoid antigen 1, isoform 7, Bullous pemphigoid antigen 1, isoforms 1/2/3/4/5/8, Bullous pemphigoid antigen 1, Isoforms 6/9/10, CATX-15, D6S1101, DKFZp5 Antibody 100ug 663 € MBS Polyclonals_1 human
MBS623603 MAGEA6, CT (Melanoma-associated Antigen 6, MAGE-6 Antigen, MAGE-3B Antigen, Cancer/Testis Antigen 1.6, CT1.6, MAGE6) Antibody 200ul 603 € MBS Polyclonals_1 human
CF13 Recombinant Human B-Cell Differentiation Antigen CD72, Lyb‑2 (N-Trx, 6His) 10 µg 202 € novo human
CA75 Recombinant Human Bone Marrow Stromal Antigen 2, BST2, Tetherin, CD317 (C-6His) 50 µg 369 € novo human
C580 Recombinant Human CD5 Antigen-Like, CD5L, Sp α, AIM (C-6His) 500 µg 1613 € novo human
CA67 Recombinant Human CD99 Antigen-Like Protein 2, CD99L2 (C-6His) 1 mg 2283 € novo human
CA64 Recombinant Human Lymphocyte Antigen 6H, LY6H (C-6His) 50 µg 496 € novo human
CA63 Recombinant Human Natural Killer Cells Antigen CD94, CD94 (N-6His) 500 µg 1613 € novo human
C365 Recombinant Human Prostate-Specific Antigen, , PSA, KLK3 (Ala18-Pro261, C-6His) 10 µg 202 € novo human
CI30 Recombinant Human Prostate-Specific Antigen, , PSA, KLK3 (Ile25-Pro261, C-6His) 500 µg 1613 € novo human
CC37 Recombinant Human T-lymphocyte Surface Antigen Ly-9, SLAMF3, CD229 (C-6His) 500 µg 1186 € novo human
CB22 Recombinant Human Tubulointerstitial Nephritis Antigen-Like 1, TINAGL1 (C-6His) 500 µg 1755 € novo human
abx261014 Anti-CD226 Protein (Recombinant) 5 µg 238 € abbex human
C781 Recombinant Mouse CD5 Antigen-Like, CD5L, SPα, AIM (C-6His) 10 µg 146 € novo human