| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CD226 Antigen is produced by our Mammalian expression system and the target gene encoding Glu19-Asn247 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
52, 8 kD |
| UniProt number: |
Q15762 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNHIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD226 (C-Fc), CD226 DNAM-1 |
| Short name: |
CD226 (C-Fc), DNAM-1, Recombinant CD226 Antigen |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD226 molecule (C-fragment c), DNAM-1, sapiens CD226 molecule protein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD226 and IDBG-4779 and ENSG00000150637 and 10666, CD226 and IDBG-643547 and ENSBTAG00000009266 and 615496, Cd226 and IDBG-163478 and ENSMUSG00000034028 and 225825, Cell surfaces, DNAM-1 and DNAM1 and PTA1 and TLiSA1, cell adhesion molecule binding, this GO :0001816 and cytokine production and biological process this GO :0002860 and positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target and biological process this GO :0002891 and positive regulation of immunoglobulin mediated immune response and biological process this GO :0005178 and integrin binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0008037 and cell recognition and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0019901 and protein kinase binding and molecular function this GO :0033005 and positive regulation of mast cell activation and biological process this GO :0045121 and membrane raft and cellular component this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process this GO :0050776 and regulation of immune response and biological process this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0060369 and positive regulation of Fc receptor mediated stimulatory signaling pathway and biological process, this GO :0005178 : integrin binding, this GO :0005178 : integrin binding and also this GO :0005515 : protein binding and also this GO :0019901 : protein kinase binding and also this GO :0050839 : cell adhesion molecule binding, this GO :0005515 : protein binding, this GO :0019901 : protein kinase binding, this GO :0050839 : cell adhesion molecule binding, CD226 molecule |
| Identity: |
16961 |
| Gene: |
CD226 |
More about : CD226 |
| Long gene name: |
CD226 molecule |
| Synonyms gene name: |
CD226 antigen |
| Synonyms: |
DNAM-1 DNAM1 PTA1 TLiSA1 |
| Locus: |
18q22, 2 |
| Discovery year: |
2003-10-02 |
| GenBank acession: |
U56102 |
| Entrez gene record: |
10666 |
| Pubmed identfication: |
8673704 |
| RefSeq identity: |
NM_006566 |
| Classification: |
CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000132809 |