| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Bone Marrow Stromal Antigen 2 is produced by our Mammalian expression system and the target gene encoding Asn49-Ser161 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
13, 67 kD |
| UniProt number: |
Q10589 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
BST2, CD317 (C-6His), Tetherin, Bone Marrow Stromal 2 |
| Short name: |
BST2, CD317 (C-6His), Tetherin, Recombinant Bone Marrow Stromal Antigen 2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD317 (C-6His), Tetherin, bone marrow stromal cell antigen 2, sapiens Bone Marrow Stromal protein 2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BST2 and IDBG-36619 and ENSG00000130303 and 684, Bst2 and IDBG-165924 and ENSMUSG00000046718 and 69550, CD317 and TETHERIN, Cell surfaces, poly(A) RNA binding, this GO :0002737 and negative regulation of plasmacytoid dendritic cell cytokine production and biological process this GO :0004871 and signal transducer activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005770 and late endosome and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008191 and metalloendopeptidase inhibitor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0009615 and response to virus and biological process this GO :0009986 and cell surface and cellular component this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0016020 and membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0030308 and negative regulation of cell growth and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0031225 and anchored component of membrane and cellular component this GO :0032956 and regulation of actin cytoskeleton organization and biological process this GO :0034341 and response to interferon-gamma and biological process this GO :0035455 and response to interferon-alpha and biological process this GO :0035456 and response to interferon-beta and biological process this GO :0042113 and B cell activation and biological process this GO :0042803 and protein homodimerization activity and molecular function this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045071 and negative regulation of viral genome replication and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0051607 and defense response to virus and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :1901253 and negative regulation of intracellular transport of viral material and biological process, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0005515 : protein binding and also this GO :0008191 : metalloendopeptidase inhibitor activity and also this GO :0042803 : protein homodimerization activity and also this GO :0044822 : poly(A) RNA binding, this GO :0005515 : protein binding, this GO :0008191 : metalloendopeptidase inhibitor activity, this GO :0042803 : protein homodimerization activity, this GO :0044822 : poly(A) RNA binding, bone marrow stromal cell antigen 2 |
| Identity: |
1119 |
| Gene: |
BST2 |
More about : BST2 |
| Long gene name: |
bone marrow stromal cell antigen 2 |
| Synonyms: |
CD317 tetherin |
| Locus: |
19p13, 11 |
| Discovery year: |
1994-11-17 |
| Entrez gene record: |
684 |
| Pubmed identfication: |
7607676 |
| RefSeq identity: |
NM_004335 |
| Classification: |
CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000191770 |