| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Fetuin A is produced by our Mammalian expression system and the target gene encoding Ala19-Ile345 is expressed with a 10His tag at the N-terminus |
| Molecular Weight: |
36, 7 kD |
| UniProt number: |
P29699 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH7, 2 um filtered solution of 20 mM Tris, 5, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
APQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKIHHHHHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
AHSG, Fetuin A (C-10His), &alpha, -2-HS-Glycoprotein |
| Short name: |
AHSG, Fetuin A (C-10His), -2-HS-Glycoprotein, Recombinant Mouse &alpha |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses |
| Alternative name: |
, Fetuin A (C-10His), alpha-2-HS-glycoprotein, -2-HS-Glycoprotein, recombinant Mouse &alpha |
| Alternative technique: |
rec |
| Alternative to gene target: |
A2HS and AHS and FETUA and HSGA, AHSG and IDBG-634683 and ENSBTAG00000000522 and 280988, AHSG and IDBG-68916 and ENSG00000145192 and 197, Ahsg and IDBG-148706 and ENSMUSG00000022868 and 11625, Extracellular, kinase inhibitor activity, this GO :0001501 and skeletal system development and biological process this GO :0001503 and ossification and biological process this GO :0004869 and cysteine-type endopeptidase inhibitor activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006907 and pinocytosis and biological process this GO :0006953 and acute-phase response and biological process this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0019210 and kinase inhibitor activity and molecular function this GO :0030500 and regulation of bone mineralization and biological process this GO :0030502 and negative regulation of bone mineralization and biological process this GO :0042326 and negative regulation of phosphorylation and biological process this GO :0045087 and innate immune response and biological process this GO :0046627 and negative regulation of insulin receptor signaling pathway and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, this GO :0004869 : cysteine-type endopeptidase inhibitor activity, this GO :0004869 : cysteine-type endopeptidase inhibitor activity and also this GO :0019210 : kinase inhibitor activity, this GO :0019210 : kinase inhibitor activity, alpha-2-HS-glycoprotein |
| Identity: |
349 |
| Gene: |
AHSG |
More about : AHSG |
| Long gene name: |
alpha 2-HS glycoprotein |
| Synonyms: |
FETUA A2HS HSGA |
| Synonyms name: |
fetuin A |
| Locus: |
3q27, 3 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
D67013 M16961 |
| Entrez gene record: |
197 |
| Pubmed identfication: |
9322749 7736783 |
| RefSeq identity: |
NM_001622 |
| Classification: |
Cystatins, type 4 |
| Havana BLAST/BLAT: |
OTTHUMG00000156605 |