| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Fetuin A is produced by our Mammalian expression system and the target gene encoding Ala19-Val367 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
36 kD, 38 |
| UniProt number: |
P02765 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM TrisHCl, 5, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKVVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
&alpha, AHSG, AHSG (C-6His), -2-HS-Glycoprotein, Fetuin-A |
| Short name: |
&alpha, AHSG, AHSG (C-6His), -2-HS-Glycoprotein, Recombinant Fetuin-A |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
&alpha, alpha-2-HS-glycoprotein, alpha-2-HS-glycoprotein (C-6His), sapiens Fetuin-A, -2-HS-Glycoprotein, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
A2HS and AHS and FETUA and HSGA, AHSG and IDBG-634683 and ENSBTAG00000000522 and 280988, AHSG and IDBG-68916 and ENSG00000145192 and 197, Ahsg and IDBG-148706 and ENSMUSG00000022868 and 11625, Extracellular, kinase inhibitor activity, this GO :0001501 and skeletal system development and biological process this GO :0001503 and ossification and biological process this GO :0004869 and cysteine-type endopeptidase inhibitor activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006907 and pinocytosis and biological process this GO :0006953 and acute-phase response and biological process this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0019210 and kinase inhibitor activity and molecular function this GO :0030500 and regulation of bone mineralization and biological process this GO :0030502 and negative regulation of bone mineralization and biological process this GO :0042326 and negative regulation of phosphorylation and biological process this GO :0045087 and innate immune response and biological process this GO :0046627 and negative regulation of insulin receptor signaling pathway and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, this GO :0004869 : cysteine-type endopeptidase inhibitor activity, this GO :0004869 : cysteine-type endopeptidase inhibitor activity and also this GO :0019210 : kinase inhibitor activity, this GO :0019210 : kinase inhibitor activity, alpha-2-HS-glycoprotein |
| Identity: |
349 |
| Gene: |
AHSG |
More about : AHSG |
| Long gene name: |
alpha 2-HS glycoprotein |
| Synonyms: |
FETUA A2HS HSGA |
| Synonyms name: |
fetuin A |
| Locus: |
3q27, 3 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
D67013 M16961 |
| Entrez gene record: |
197 |
| Pubmed identfication: |
9322749 7736783 |
| RefSeq identity: |
NM_001622 |
| Classification: |
Cystatins, type 4 |
| Havana BLAST/BLAT: |
OTTHUMG00000156605 |