Fetuin-A Antibody / AHSG

Contact us
Catalog number: R31869
Price: 703 €
Supplier: acr
Product name: Fetuin-A Antibody / AHSG
Quantity: 96 Tests
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Fetuin-A / AHSG
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: ELISA, IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the AHSG antibody should be determined by the researcher
Intented use: This AHSG antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P02765
Purity: Antigen affinity
Description: Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood, It is involved in several functions, Its gene is mapped to 3q27, The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, also known as Fetuin-A, brain development and the formation of bone tissue, is a protein that in humans is encoded by the AHSG gene, such as endocytosis, Alpha-2-HS-glycoprotein (AHSG)
Immunogen: Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the AHSG antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Fetuin-A / AHSG
Short name: Fetuin-A Antibody / AHSG
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Fetuin-A (Antibody to) / alpha-2-HS-glycoprotein
Alternative technique: antibodies
Alternative to gene target: A2HS and AHS and FETUA and HSGA, AHSG and IDBG-634683 and ENSBTAG00000000522 and 280988, AHSG and IDBG-68916 and ENSG00000145192 and 197, Ahsg and IDBG-148706 and ENSMUSG00000022868 and 11625, Extracellular, kinase inhibitor activity, this GO :0001501 and skeletal system development and biological process this GO :0001503 and ossification and biological process this GO :0004869 and cysteine-type endopeptidase inhibitor activity and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006907 and pinocytosis and biological process this GO :0006953 and acute-phase response and biological process this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0019210 and kinase inhibitor activity and molecular function this GO :0030500 and regulation of bone mineralization and biological process this GO :0030502 and negative regulation of bone mineralization and biological process this GO :0042326 and negative regulation of phosphorylation and biological process this GO :0045087 and innate immune response and biological process this GO :0046627 and negative regulation of insulin receptor signaling pathway and biological process this GO :0050727 and regulation of inflammatory response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, this GO :0004869 : cysteine-type endopeptidase inhibitor activity, this GO :0004869 : cysteine-type endopeptidase inhibitor activity and also this GO :0019210 : kinase inhibitor activity, this GO :0019210 : kinase inhibitor activity, alpha-2-HS-glycoprotein
Identity: 349
Gene: AHSG | More about : AHSG
Long gene name: alpha 2-HS glycoprotein
Synonyms: FETUA A2HS HSGA
Synonyms name: fetuin A
Locus: 3q27, 3
Discovery year: 1986-01-01
GenBank acession: D67013 M16961
Entrez gene record: 197
Pubmed identfication: 9322749 7736783
RefSeq identity: NM_001622
Classification: Cystatins, type 4
Havana BLAST/BLAT: OTTHUMG00000156605

Related Products :

C425 Recombinant Human Fetuin-A, AHSG, α-2-HS-Glycoprotein, AHSG (C-6His) 50 µg 273 € novo human
R31869 Fetuin-A Antibody / AHSG 0.1mg 406 € NJS poly human
MBS240601 Goat Polyclonal to Human AHSG / Fetuin Antibody 50ug 597 € MBS Polyclonals_1 human
MBS244249 Sheep Polyclonal to Human AHSG / Fetuin Antibody 0.25 miligrams 597 € MBS Polyclonals_1 human
MBS620685 Fetuin-A (AHSG) 100ug 575 € MBS Polyclonals_1 human
GWB-BIG078 Recombinant Human Fetuin A/AHSG bulk Ask price € genways bulk human
RP-0679H Recombinant Human Fetuin-A / AHSG / FETUA Protein (His Tag) 50μg 624 € adv human
CP26 Recombinant Macaca mulatta α-2-HS-Glycoprotein, AHSG, Fetuin A (C-10His) 10 µg 110 € novo human
CP25 Recombinant Mouse α-2-HS-Glycoprotein, , AHSG, Fetuin A (C-10His) 500 µg 1009 € novo human
RP-1283M Recombinant Mouse Fetuin-A / AHSG Protein (His Tag) 50μg 624 € adv mouse
GENTAUR-58be07f55705d Anti- fetuin-B Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be07f5a5970 Anti- fetuin-B Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdc30919bbc Anti- Fetuin B (FETUB) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc3096e8b7 Anti- Fetuin B (FETUB) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc3704b320 Anti- Fetuin B (FETUB) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc37238190 Anti- Fetuin B (FETUB) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc6fd978cb Anti- Fetuin B (FETUB) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc75e73b4e Anti- Fetuin B (FETUB) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc75ed5a54 Anti- Fetuin B (FETUB) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcf1e98d8b Anti- Fetuin B (FETUB) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdcff7c1f62 Anti- Fetuin B (FETUB) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcff8348eb Anti- Fetuin B (FETUB) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdd032bdc28 Anti- Fetuin B (FETUB) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd3890b319 Anti- Fetuin B (FETUB) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd423407ac Anti- Fetuin B (FETUB) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd46e4b73e Anti- Fetuin B (FETUB) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bddb0351d21 Anti- Fetuin B (FETUB) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bddb5ee4d66 Anti- Fetuin B (FETUB) Antibody 100ug 575 € MBS Polyclonals human
BB-EK0757 anti-Human Fetuin A ELISA Kit Antibody 96 Tests 761 € acr human
CEK1149 anti-Human Fetuin A ELISA Kit Antibody 96 Tests 703 € acr human