| Reacts with: |
Vacciniavirus |
| Source: |
proteins, Recombinants or rec |
| Description: |
2 or 3 and , However, In this sense, When such chemical-signals couple or bind to a receptor, a change in the electrical-activity of a cell, acetylcholine, am olfactory receptor is a protein-molecule that recognizes and responds to , an acetylcholine-receptor recognizes and responds to its endogenous-ligand, chemokinesor cytokines e, e, sometimes in pharmacology, such as enzymes, the term is also used to include other proteins that are drug-targets, they cause some form of cellular/tissue-response, transporters and ion-channels, The receptors are ligand binding factors of type 1, endogenous-chemical signals, g, g, protein-molecules , that receive chemical-signals from outside a cell |
| Molecular Weight: |
2 kD, 39 |
| UniProt number: |
P25213 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
HSYAIDIENEITEFFNKMRDTLPAKDSKWLNPACMFGGTMNDIAALGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTYELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIKYSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYFENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Group: |
recombinants |
| Gene target: |
&beta, receptor B18, Vaccinia Virus Soluble Interferon &alpha |
| Short name: |
&beta, receptor B18, Recombinant Vaccinia Virus Soluble Interferon &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Viruses |
| Alternative name: |
&beta, receptor B18, recombinant Vaccinia Virus Soluble Interferon &alpha |
| Alternative technique: |
rec |
| Identity: |
7702 |
| Gene: |
NDUFB7 |
More about : NDUFB7 |
| Long gene name: |
NADH:ubiquinone oxidoreductase subunit B7 |
| Synonyms gene name: |
18kDa , 7, 7 (18kD, B18) NADH dehydrogenase (ubiquinone) 1 beta subcomplex, NADH dehydrogenase (ubiquinone) 1 beta subcomplex |
| Synonyms: |
B18 CI-B18 MGC2480 |
| Synonyms name: |
NADH-ubiquinone oxidoreductase B18 subunit complex I B18 subunit |
| Locus: |
19p13, 12 |
| Discovery year: |
1997-12-09 |
| Entrez gene record: |
4713 |
| Pubmed identfication: |
9763677 10830904 |
| RefSeq identity: |
NM_004146 |
| Classification: |
NADH:ubiquinone oxidoreductase supernumerary subunits |
| Havana BLAST/BLAT: |
OTTHUMG00000183291 |