Recombinant Vaccinia Virus Soluble Interferon α, β receptor B18

Contact us
Catalog number: CM32
Price: 2283 €
Supplier: novo
Product name: Recombinant Vaccinia Virus Soluble Interferon α, β receptor B18
Quantity: 1 mg
Other quantities: 1 mg 2283€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Vacciniavirus
Source: proteins, Recombinants or rec
Description: 2 or 3 and , However, In this sense, When such chemical-signals couple or bind to a receptor, a change in the electrical-activity of a cell, acetylcholine, am olfactory receptor is a protein-molecule that recognizes and responds to , an acetylcholine-receptor recognizes and responds to its endogenous-ligand, chemokinesor cytokines e, e, sometimes in pharmacology, such as enzymes, the term is also used to include other proteins that are drug-targets, they cause some form of cellular/tissue-response, transporters and ion-channels, The receptors are ligand binding factors of type 1, endogenous-chemical signals, g, g, protein-molecules , that receive chemical-signals from outside a cell
Molecular Weight: 2 kD, 39
UniProt number: P25213
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HSYAIDIENEITEFFNKMRDTLPAKDSKWLNPACMFGGTMNDIAALGEPFSAKCPPIEDSLLSHRYKDYVVKWERLEKNRRRQVSNKRVKHGDLWIANYTSKFSNRRYLCTVTTKNGDCVQGIVRSHIRKPPSCIPKTYELGTHDKYGIDLYCGILYAKHYNNITWYKDNKEINIDDIKYSQTGKELIIHNPELEDSGRYDCYVHYDDVRIKNDIVVSRCKILTVIPSQDHRFKLILDPKINVTIGEPANITCTAVSTSLLIDDVLIEWENPSGWLIGFDFDVYSVLTSRGGITEATLYFENVTEEYIGNTYKCRGHNYYFEKTLTTTVVLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Group: recombinants
Gene target: &beta, receptor B18, Vaccinia Virus Soluble Interferon &alpha
Short name: &beta, receptor B18, Recombinant Vaccinia Virus Soluble Interferon &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Viruses
Alternative name: &beta, receptor B18, recombinant Vaccinia Virus Soluble Interferon &alpha
Alternative technique: rec
Identity: 7702
Gene: NDUFB7 | More about : NDUFB7
Long gene name: NADH:ubiquinone oxidoreductase subunit B7
Synonyms gene name: 18kDa , 7, 7 (18kD, B18) NADH dehydrogenase (ubiquinone) 1 beta subcomplex, NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Synonyms: B18 CI-B18 MGC2480
Synonyms name: NADH-ubiquinone oxidoreductase B18 subunit complex I B18 subunit
Locus: 19p13, 12
Discovery year: 1997-12-09
Entrez gene record: 4713
Pubmed identfication: 9763677 10830904
RefSeq identity: NM_004146
Classification: NADH:ubiquinone oxidoreductase supernumerary subunits
Havana BLAST/BLAT: OTTHUMG00000183291

Related Products :

CM32 Recombinant Vaccinia Virus Soluble Interferon α, β receptor B18 500 µg 1613 € novo human
MBS610191 Fragilis (1 8U, Ifitm3, Interferon Induced Transmembrane Protein 3, Interferon inducible protein 1 8U, Interferon Inducible Protein 15, Interferon Inducible Protein Homolog) Antibody 100ug 558 € MBS Polyclonals_1 human
MBS619896 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX Receptor beta, LXRa, LXR-a, LXRalpha, LXRb, LXR-b, LXRbeta, NERI, NER-I, NR1H2, NR1H3, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 100ug 763 € MBS Polyclonals_1 human
MBS611189 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX receptor beta, LXRa, LXRalpha, LXRb, LXRbeta, NERI, NR1H2, NR1H3, Nuclear Orphan Receptor LXR alpha, Nuclear Orphan Receptor LXR beta, Nuclear Receptor Antibody 100ug 735 € MBS Polyclonals_1 human
MBS617658 Nuclear Receptor LXR beta (NR1H2, Liver X Receptor beta, LX Receptor beta, LXRB, LXR-b, LXR beta, NER1, NERI, Nuclear Orphan Receptor LXR beta, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 2, Oxysterols Receptor LXR beta, RIP15, Stero Antibody 100ug 735 € MBS Polyclonals_1 human
GENTAUR-58bd5c14e1da9 Macaca fascicularis Melanoma-associated antigen B18 (MAGEB18) 100ug 1984 € MBS Recombinant Proteins human
GENTAUR-58bd5c15310bd Macaca fascicularis Melanoma-associated antigen B18 (MAGEB18) 1000ug 1984 € MBS Recombinant Proteins human
GENTAUR-58bd5c156bede Macaca fascicularis Melanoma-associated antigen B18 (MAGEB18) 100ug 2498 € MBS Recombinant Proteins human
GENTAUR-58bd5c15b6e23 Macaca fascicularis Melanoma-associated antigen B18 (MAGEB18) 1000ug 2498 € MBS Recombinant Proteins human
MBS612461 Interferon Stimulating Gene 15 (ISG15, 15kD Ubiquitin-like Modifier GIP2, G1P2, Interferon Induced 15kD Protein, IFI15, Interferon alpha Inducible Protein, Interferon Stimulated Protein 15kD, Ubiquitin Cross-reactive Protein, UCRP) Antibody 500ug 829 € MBS Polyclonals_1 human
MBS624576 IL22RA2 (IL-22 Receptor Subunit alpha-2, IL-22 Receptor Subunit alpha-2, IL-22R-alpha-2, IL-22RA2, Cytokine Receptor Family Type 2, Soluble 1, CRF2-S1, IL-22-binding Protein, IL-22BP, IL22BP, ZcytoR16) (APC) 100 Tests 768 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
MBS614704 Interferon alpha-Inducible Protein 27 (IFI27, 2310061N23Rik, FAM14D, Interferon alpha-Induced 11.5kD Protein, ISG12, ISG12(a) Protein, P27) Antibody 100ug 785 € MBS Polyclonals_1 human
MBS622393 Adrenergic Receptor, beta 2 (ADRB2, Adrenergic, Beta-2-, Receptor, Surface [Homo sapiens], HGNC:286, ADRB2R, ADRBR, B2AR, BAR, BETA2AR, beta-2 Adrenergic Receptor, beta-2 Adrenoceptor, Catecholamine Receptor) 100ug 707 € MBS Polyclonals_1 human
GENTAUR-58b9f6887db4c Vaccinia virus Pro-vaccinia growth factor (VGF) 100ug 1321 € MBS Recombinant Proteins human
GENTAUR-58b9f68b08b74 Vaccinia virus Pro-vaccinia growth factor (VGF) 1000ug 1321 € MBS Recombinant Proteins human
GENTAUR-58b9f68b7cccd Vaccinia virus Pro-vaccinia growth factor (VGF) 100ug 1824 € MBS Recombinant Proteins human
GENTAUR-58b9f68c08ceb Vaccinia virus Pro-vaccinia growth factor (VGF) 1000ug 1824 € MBS Recombinant Proteins human
GENTAUR-58bab45e44001 Vaccinia virus Pro-vaccinia growth factor (VGF) 100ug 1321 € MBS Recombinant Proteins human
GENTAUR-58bab45ee7547 Vaccinia virus Pro-vaccinia growth factor (VGF) 1000ug 1321 € MBS Recombinant Proteins human
GENTAUR-58bab45f415c5 Vaccinia virus Pro-vaccinia growth factor (VGF) 100ug 1824 € MBS Recombinant Proteins human
GENTAUR-58bab46017289 Vaccinia virus Pro-vaccinia growth factor (VGF) 1000ug 1824 € MBS Recombinant Proteins human
GENTAUR-58bd651c6c98a Vaccinia virus Pro-vaccinia growth factor (VGF) 100ug 1321 € MBS Recombinant Proteins human
GENTAUR-58bd651cc1050 Vaccinia virus Pro-vaccinia growth factor (VGF) 1000ug 1321 € MBS Recombinant Proteins human
GENTAUR-58bd651d17c44 Vaccinia virus Pro-vaccinia growth factor (VGF) 100ug 1824 € MBS Recombinant Proteins human
GENTAUR-58bd651d67851 Vaccinia virus Pro-vaccinia growth factor (VGF) 1000ug 1824 € MBS Recombinant Proteins human
abx167010 Anti-Interferon alpha/beta Receptor 2 Protein (Recombinant) 10 μg 412 € abbex human
C358 Recombinant Human Interferon α, β Receptor 1, IFNAR1 (C-6His) 500 µg 1613 € novo human
C476 Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-6His) 50 µg 273 € novo human
CD10 Recombinant Human Interferon α, β Receptor 2, IFNAR2 (C-Fc) 1 mg 2283 € novo human