| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human MFAP4 is produced by our Mammalian expression system and the target gene encoding Val22-Ala255 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
27, 5 kD |
| UniProt number: |
P55083 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGVGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRAVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
MFAP4(C-6His), Microfibril-Associated Glycoprotein 4 |
| Short name: |
MFAP4(C-6His), Recombinant Microfibril-Associated Glycoprotein 4 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
microfibrillar-associated protein 4(C-6His), sapiens Microfibril-Associated Glycoprotein 4, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, MFAP4 and IDBG-34759 and ENSG00000166482 and 4239, MFAP4 and IDBG-637769 and ENSBTAG00000006187 and 286766, Mfap4 and IDBG-183000 and ENSMUSG00000042436 and 76293, protein binding, this GO :0001527 and microfibril and cellular component this GO :0003674 and molecular function and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0007155 and cell adhesion and biological process this GO :0009650 and UV protection and biological process this GO :0010712 and regulation of collagen metabolic process and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0043206 and extracellular fibril organization and biological process this GO :0048251 and elastic fiber assembly and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071493 and cellular response to UV-B and biological process this GO :0071953 and elastic fiber and cellular component, this GO :0003674 : molecular_function, this GO :0003674 : molecular_function and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, microfibrillar-associated protein 4 |
| Identity: |
7035 |
| Gene: |
MFAP4 |
More about : MFAP4 |
| Long gene name: |
microfibrillar associated protein 4 |
| Synonyms name: |
microfibril-associated glycoprotein 4 |
| Locus: |
17p11, 2 |
| Discovery year: |
1994-11-17 |
| GenBank acession: |
L38486 |
| Entrez gene record: |
4239 |
| Pubmed identfication: |
7633408 |
| RefSeq identity: |
NM_002404 |
| Classification: |
Fibrinogen C domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000059585 |